Answer: A Fixed Action Pattern
Explanation:
A fixed action pattern is an ethological term and off course a natural activity pattern that causes animals to act in a specific behavior pattern distinctive to their species. It is a pattern that is relatively unchangeable within the species and usually ends even when it is interrupted. You can say that, it is innate releasing mechanism or network where sign stimulus exists, once released from neural network; fixed action pattern leads to completion as well.
Answer:
The presence of predators of deer which does not allow increase in the population of deer year after year.
Explanation:
In an forest ecosystem, one animal controls the population of another organisms and thus there is no increase in the population of that organism and the ecosystem is in equilibrium state. The population of deer did not increase due to the presence of predators such as lion, cheetah etc and the net population is 0.
They have the same mass as the mass of the reactants. evidence to back this up is the law of conservation of mass
Answer:
<em>Human interaction within ecosystems can have both positive and negative impacts on the levels of biodiversity. The impact of an increase in the human population , including increased waste, deforestation , peat bog destruction and global warming has been to reduce biodiversity .</em>
<em>hope</em><em> </em><em>it helps u</em><em> </em>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
