1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Keith_Richards [23]
3 years ago
10

I need help plz math

Mathematics
2 answers:
My name is Ann [436]3 years ago
7 0

Answer:

D/40

Step-by-step explanation:

The answer is D because if you were to put them in the correct order it would be

21, 40, 52, 58, 72, 75, 96

      Q1        Q2       Q3

Q1 is quartile 1 so the answer is 40

Hope this helps!

QveST [7]3 years ago
3 0

Answer:

Q1 = 40

Step-by-step explanation:

Set up numbers from least to greatest

21, 40, 52, 58, 72, 75, 96

First, find the median,

Median is: 58

Now Q1 is all numbers before the median (without counting the median)

21, 40, 52

The median here is 40

You might be interested in
Ill mark brainlist plss help
mojhsa [17]

Answer:

w=20

Step-by-step explanation:

Solve for  w  by cross multiplying.

6 0
3 years ago
Read 2 more answers
Identify each expression with a sum of x2 + 3x +1.
Yuki888 [10]

Answer:

There are no like terms.

Step-by-step explanation:

5 0
3 years ago
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
3 years ago
Read 2 more answers
[100 ÷ (27 – 22)] – 3 • 5 + 25
oksian1 [2.3K]
Answer is 30
you can use PEMDAS to help you on further questions like this
P-Parenthesis
E-Exponents
M/D-Multiplication/Division solved in order from left to right
A/S-Addition/Subttaction solved in order from left to right
7 0
4 years ago
Pls help! given: -2(x-4)=2x+12 Prove: x=-1
nata0808 [166]

Answer:

X= -1

Step-by-step explanation:

In pic

(hope this helps can I pls have brainlist (crown) ☺️)

7 0
3 years ago
Other questions:
  • How would you get 50% of the vitamin c
    10·1 answer
  • Find the sum of the arithmetic sequence. 5, 7, 9, 11, ..., 23
    5·1 answer
  • Nathan is buying a cell phone for his business. The regular price of the cell phone is $179. If he buys the phone in the next 2
    11·2 answers
  • Fraction 2 over 3y = Fraction 1 over 4. y = ___?
    7·1 answer
  • b is the midpoint of AC. a has coordinates (9.11), and B has coordinates (-10,5). find the coordinates of c.
    8·1 answer
  • An equation or inequality containing one or more variables. vocabulary matching: _________ grouping symbol _________ order of op
    11·1 answer
  • Veronica’s velocity was measured as 4.3 m/s. She displaced 20 meters in 4.7 seconds. Which piece of information is missing for t
    12·2 answers
  • Giúp em nhanh ạ <br><br>(x+2)(x−2)−(x−3)(x+5)=0
    8·1 answer
  • Is 4 a factor of 10u+34v
    15·1 answer
  • Do these three segments make a right triangle? 14cm, 23cm, and 25cm
    14·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!