Answer:
Radioisotopes are radioactive isotopes of an element
Explanation: Radioactive isotopes are detected by: photographic film.
a cloud or bubble chamber.
a liquid scintillation detector.
a Geiger-Muller counter.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
phenotype is Rr, or rr genotype is RR, or Rr.
Explanation:
because we combine two types of letters so we may find out what compartment of the Punnet square represents.
The correct answer is A.
Animal cells do not have a cell wall.
A cell wall is the rigid, outermost covering of plant cells and is made up of cellulose. It is absent in animal cells. The cell wall is visible under a light microscope.
Animal cells are instead covered by a cell membrane. It is made up of lipids, proteins, and small amounts carbohydrates. It is a thin and delicate structure that can only be seen using an electron microscope.
