1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
leva [86]
3 years ago
9

If two objects are moving at a constant speed with the same velocity, what will make the

Biology
1 answer:
Charra [1.4K]3 years ago
4 0

Answer:

<em>The velocity can change by changing the direction</em>

Explanation:

If the direction changes, then the velocity changes even though the speed is constant. Hope this helps!

You might be interested in
K12 ELA 7th grade science interim
joja [24]

Answer:

wait what grade are u in?

7 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
4 years ago
What would happen to a cell if all the organelles it contained stopped working?
butalik [34]

Answer:                                                                                                                        If the nucleus didn't exist, the cell wouldn't have direction and the nucleolus, which is inside the nucleus, wouldn't be able to produce ribosomes. ... If the cell membrane were gone, the cell would be uprotected. Everything would lead to the death of the cell.

A. The cell would die.

Explanation:

6 0
3 years ago
Unicellular protists with two flagella that are photosynthetic and cause red tides are called
worty [1.4K]

<span>C dinoflagellates

</span><span><span>A flagella (or flagellum plural) is a long strand like structure that is located in the front end part (more like a tail in front). It flips to the left and right in order for the organism to move. It is connected to the reservoir, which contains the storage of food for the organism.<span>

</span></span>These unicellular organisms are responsible for breaking down materials in the earth. They assist with the decomposition of the dead and decaying matter that can be found on the earth's surface. This break down also makes up natural fertiliser for the plants which then grow up fertilised. These unicellular organisms are also an essential part of the nitrogen cycle. They change the nitrogen from the environment and turn them into absorbable nitrates for the plants, which is an essential part of the plants' food.
</span>


7 0
3 years ago
Read 2 more answers
Scientific have tried to explain the rate of evolution over time by means of
vlabodo [156]
The rate of evolution is the means of
Darwinism
8 0
3 years ago
Other questions:
  • Which is the largest source of human-caused air pollution in the united states?
    9·1 answer
  • During an experiment, you place cells from the xylem tissue of a flower, Narcissus pseudonarcissus, into a beaker containing dis
    8·1 answer
  • What is biodiversity? What area of the world is often referred to as the hotspot
    11·1 answer
  • #1 Two new methods for cleaning oil spills are being tested and are in phase one of their trials.
    9·1 answer
  • Rocky shore and sandy shore similarities
    11·1 answer
  • Which atom contains exactly 15 protons?
    9·2 answers
  • 5 questions :
    11·1 answer
  • 2. How does temperature change in the troposphere?
    10·2 answers
  • A person is pushing on a heavy door, trying to slide it open. How do the forces change when a friend helps push the door? Questi
    7·1 answer
  • Moderates weather so that highs and lows are less extreme<br><br> I need the factor of that
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!