Answer:
wait what grade are u in?
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: If the nucleus didn't exist, the cell wouldn't have direction and the nucleolus, which is inside the nucleus, wouldn't be able to produce ribosomes. ... If the cell membrane were gone, the cell would be uprotected. Everything would lead to the death of the cell.
A. The cell would die.
Explanation:
<span>C dinoflagellates
</span><span><span>A flagella (or flagellum plural) is a long strand like structure that is located in the front end part (more like a tail in front). It flips to the left and right in order for the organism to move. It is connected to the reservoir, which contains the storage of food for the organism.<span>
</span></span>These unicellular organisms are responsible for breaking down materials in the earth. They assist with the decomposition of the dead and decaying matter that can be found on the earth's surface. This break down also makes up natural fertiliser for the plants which then grow up fertilised. These unicellular organisms are also an essential part of the nitrogen cycle. They change the nitrogen from the environment and turn them into absorbable nitrates for the plants, which is an essential part of the plants' food.
</span>
The rate of evolution is the means of
Darwinism
