A tree is considered living because it takes in nutrients like other living things. The tree is also made up of cells which all living things are made up of. Trees can also produce offspring. Just like any other living thing.
I’m pretty sure it’s called an EKG, or something close to that.
C. They are able to be divided by a chemical reaction.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Energy in the initial form of glucose is used with oxygen to produce carbon dioxide, water and energy in the form of ATP which is taken up by the cell in order to perform cellular processes.
