Answer:
Gossypium belongs to the Gossypium arboreum L. species.
The correct answer would be A. seal as paramecium, bacterium, and amoeba are all single-celled organisms. Thus, they cannot be an organism with tissues.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Hurricane Katrina was a density-dependent factor because this disaster affected everyone in the area. It did not selectively have an effect like
