All categories

3 years ago

Which sentence best describes what this organism will like at the end of its growth period

Biology

1 answer:

Yakvenalex [24]3 years ago

6 0

In the image above the best answer choice would be D. Because it just makes more sense than the other choices.

You might be interested in

What happens during photosynthesis? *

Alexeev081 [22]

Answer:

A) Apt is created in the light reactions and is used in the Calvin cycle

6 0

2 years ago

Of the following phyla, which are non-seed producing and non-vascular?

Masteriza [31]

Answer:

Anthocerophyta, Bryophyta, Hepatophyta.

Explanation:

Non vascular plants are defined as the plants which contains phloem, and xylem without the vascular system. They are containing simpler tissues which are specialized for internal transport of water.

They include bryophyta, hornworts (anthocerophyta), liverworts (hepatophyta) mosses, and some algae. Non vascular plants reproduce with the help of spores, and do not produce fruit, and flowers.

3 0

3 years ago

Determining the likelihood of two samples with the same characteristics being from two different sources is calculating

Artyom0805 [142]

Answer: Comparison

Comparison is the determining the likelihood of two samples with the same characteristic being from two different sources.

Explanation:

While comparison is made there is always a certain similar character taken which are common in nature. After the two topics are placed in front then decision can be made easily on various basis. 

Comparison does gives the definition for the good and the bad, pretty and ugly. It can also be sued in a negative way to dominate someone.

6 0

3 years ago

Which level of Ecology explores the relationships among different species and the environment?

vichka [17]

Answer:

I an expert in Biology, trust me.

I an expert in Biology, trust me.Your answer is Ecosystems.

Explanation:

An ecosystem is a geographic area where plants, animals, and other organisms, as well as weather and landscape, work together to form a bubble of life. Ecosystems contain biotic or living, parts, as well as abiotic factors, or nonliving parts.

If you like my answer you can mark my answer as Brainliest.

And if you have any questions do not hesitate to ask.

8 0

2 years ago

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0

3 years ago