1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Artyom0805 [142]
3 years ago
9

Help anybody ?? i will mark brainliest !!

Biology
1 answer:
inessss [21]3 years ago
5 0

Answer:

u know the rules and so do i

Explanation:

You might be interested in
A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi
Digiron [165]

Answer:

Explanation:

  1. ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
  2. ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
  3. Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.
4 0
3 years ago
Intermodal containers are used interchangeably for two or more modes of transportation.
charle [14.2K]
Intermodal containers are used interchangeably for two or more modes of transportatio nsuch as from ship to rail to truck. These genius materials are designed to prevent unloading and reloading of cargo that consumes a lot of time and effort. These containers are designed also for storage and transport of materials and products efficiently especially in global transport systems --- exporting and importing. 
3 0
4 years ago
DNA polymerase is a primer-dependent enzyme that functions only in the 5'-3' direction. These are the two most fundamental conce
Sedaia [141]

Answer:

2. DNA polymerase II, DNA polymerase B

Explanation:

DNA polymerase II (also known as DNA Pol II or Pol II) is a prokaryotic DNA-Dependent DNA polymerase encoded by the PolB gene. DNA Polymerase II is an 89.9-kDa protein and is a member of the B family of DNA polymerases. The enzyme has 5′→3′ DNA synthesis capability as well as 3′→5′ exonuclease proofreading activity.

It was first isolated by Thomas Kornberg in 1970

4 0
3 years ago
Chloroplasts would be found in which eukaryotic organisms?
meriva

Answer:

oak tree

Explanation:

because the others aren't plants

8 0
3 years ago
Natural selection works directly on
sesenic [268]

Natural selection works directly on the phenotype, but not the genotype.

8 0
3 years ago
Read 2 more answers
Other questions:
  • Why is vinegar used in food preservation
    7·1 answer
  • What does a positive result for the endospore stain indicate about the organism?
    6·1 answer
  • At the end of which period did nearly 3/4 of all species of life on earth go extinct in a very short time interval?
    9·1 answer
  • What effect might many years of low precipitation have on water supply?
    9·1 answer
  • Are living and non living things made of the same ingredients?why or why not?
    14·1 answer
  • Darius has made the hypothesis that "the more fertilizer a plant gets, the more leaves it will have." Do the data in the table b
    9·1 answer
  • A male giraffe has 31 chromosomes in each of its sex cells. How many would be present in its body cells?
    9·1 answer
  • _____ rges arise because in a way children inherit both their genes and their environment from their parents. these rges are giv
    15·2 answers
  • In the table above, all organisms have?
    14·2 answers
  • Which of the following plants and trees ? ( mango and pine . rose and coffee . cucumber and gourd .)​
    11·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!