50% because both are the same Genotyle dominant wise and recessive wise so it will have a fifty fifty chance of having wrinkled seeds
Answer;
-Down the concentration gradients; evenly distributed
Diffusing molecules move down the concentration gradients until they are evenly distributed.
Explanation;
Diffusion is the movement of particles from an area of higher concentration to an area of lower concentration.
-Whenever a substance exists in greater concentration on one side of a semipermeable membrane, such as cell membranes, any substance that can move down its concentration gradient across the membrane will do so. If the substances can move across the cell membrane without the cell expending energy, the movement of molecules is called passive transport.
-The mechanism of molecules moving across a cell membrane from the side where they are more concentrated to the side where they are less concentrated is a form of passive transport called simple diffusion.
Answer:
The answer to the question is C
Explanation:
It is used for all I and II and III
Heated waste water product from production plants :(, natural gas plants, nuclear plants, textile or paper industries
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
