ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.

4 0

3 years ago

An organism that can produce its own energy using sunlight is called what

labwork [276]

Answer:

a plant

Explanation:

6 0

3 years ago

Read 2 more answers

Gene expression in eukaryotic cells is controlled by transcription factors, which are ________.

Gelneren [198K]

<span>B. proteins Proteins play major role in the expression of gene in eukaryotes. They are called transcription factors. Transcription is the copying of DNA sequence. Here proteins play as ON OFF factors for gene expression. They regulate the process of transcription</span>

3 0

3 years ago

Directions:

Simora [160]

Two other patterns of inheritance include natural eye color and hair color.

7 0

3 years ago