1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Aleks04 [339]
3 years ago
15

What did scientists observe using the earliest microscopes.

Biology
1 answer:
kodGreya [7K]3 years ago
3 0

Answer:

Tiny organisms. Hope this helps!

Explanation:

You might be interested in
What would happen to an organism if its cell membranes became permeable to most substance
Hatshy [7]
A) It would die as harmful substances entered the cell
5 0
4 years ago
Read 2 more answers
A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi
Digiron [165]

Answer:

Explanation:

  1. ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
  2. ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
  3. Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.
4 0
3 years ago
An organism that can produce its own energy using sunlight is called what
labwork [276]

Answer:

a plant

Explanation:

6 0
3 years ago
Read 2 more answers
Gene expression in eukaryotic cells is controlled by transcription factors, which are ________.
Gelneren [198K]
<span>B. proteins Proteins play major role in the expression of gene in eukaryotes. They are called transcription factors. Transcription is the copying of DNA sequence. Here proteins play as ON OFF factors for gene expression. They regulate the process of transcription</span>
3 0
3 years ago
Directions:
Simora [160]
Two other patterns of inheritance include natural eye color and hair color.
7 0
3 years ago
Other questions:
  • How does lying on a rock help a turtle maintain homeostasis?
    10·1 answer
  • Hemophilia is a sex-linked trait. A hemophilic male produces offspring with a carrier female. What are the chances that the fema
    15·2 answers
  • The area of the brain heavily involved in the formation of lasting, long-term memories is select one:
    8·1 answer
  • Reactions such as oxidation or deamination can alter dna bases. after replication, these changes may result in point mutations.
    9·1 answer
  • What are the last of phases in the cell cycle?
    9·1 answer
  • Qualitative observation science definition
    7·1 answer
  • The basic structural unit of the nervous structure is the
    8·1 answer
  • Scientists use the scientific method in order to: (select all that apply) answer questions. provide an objective, standardized a
    14·1 answer
  • How do authors create mood in poems​
    5·1 answer
  • Please HELP ASAP ON A TIMED QUIZ!!!!!!!The image shows a line graph.
    13·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!