1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
nignag [31]
3 years ago
9

In the triangle above, the cosine of a is 0.8.What is sine of b?

Mathematics
1 answer:
Natalka [10]3 years ago
5 0

Answer:

sin b = 0.8

Step-by-step explanation:

Since a and b are complementary angles , then

sin b = cos a = 0.8

You might be interested in
Which step in the solution contains the first error ?? Please helpp
kumpel [21]

Answer:

step 4 I believe

Step-by-step explanation:

6 0
3 years ago
Read 2 more answers
How are fractions and decimals related
Airida [17]
A fraction is a short way to write a division problem. When you see a fraction, it means "the top number divided by the bottom number". When you actually DO the division, the answer is the decimal that's equal to the fraction.
7 0
3 years ago
Read 2 more answers
What is the value of x in the equation −x = 4 − 3x + 6?<br><br> 5<br> 10<br> −5<br> −10
ddd [48]
Combine like terms

-x = 4 + 6 - 3x
-x = 10 - 3x

Isolate the x, add 3x to both sides

-x (+3x) = 10 - 3x (+3x)

-x + 3x = 10

Simplify. Combine like terms

-x + 3x = 10

2x = 10

Isolate the x, divide 2 from both sides

2x/2 = 10/2

x = 10/2

x = 5

x = 5, or A is your answer

hope this helps
8 0
3 years ago
Read 2 more answers
You are about to toss
Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0
3 years ago
875 rounded to nearest ten
velikii [3]
880
Underline the number in the tens place
look to the right
if number is greater than 5
add 1 to the underlined number
leave the numbers behind the underlined number zero
4 0
3 years ago
Read 2 more answers
Other questions:
  • Sonny has $75 to spend. The purchase he wants to make requires $93.if he borrows the extra money that he needs,how much does he
    6·2 answers
  • what interest rate is needed to turn $2500 into $15,000 in 14 years if interest is compounded weekly?
    8·1 answer
  • What the answer for the question
    14·2 answers
  • Mr Floyd is laying grass squares in his backyard. He will cover the entire yard except for the vegetable garden. How many square
    12·2 answers
  • Two coins are tossed at the same time. what is the probability they both land on tails?
    6·2 answers
  • Find a formula for the sequence 3, 9/4, 27/7, 81/10,... in sigma notation​
    5·1 answer
  • find the length of DE if D is between points C and E, CD = 6.5 centimeters, and CE = 13.8 centimeters.
    9·1 answer
  • You need 1 1/4 cup of sugar to make 20 cookies to make 12 cookies how much sugar do you need​
    7·1 answer
  • Can anyone help me pls?
    14·2 answers
  • 100= -25h +(h)(5) To make the equation true, what is the value of h?
    6·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!