1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Gnoma [55]
2 years ago
9

Which of the following is NOT a characteristic of animals ?

Biology
1 answer:
777dan777 [17]2 years ago
7 0

Answer:

The answer is "A"

Explanation:

They cannot make their own food, they are heterotrophs

You might be interested in
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Why do the various elements important to life on earth? And how does chemistry relate to life?
Savatey [412]

Chemical elements are important to living organisms because they make up the organic molecules that are found in all living things

8 0
3 years ago
A type of standing-water habitat in which the soil is acidic and decay is slow is called a _____.
Roman55 [17]

Answer:

Bog

Explanation:

A type of standing-water habitat in which the soil is acidic and decay is slow is called a <u>bog</u>.

4 0
3 years ago
Which of the following best describes the transfer of energy and matter in photosynthesis?
VLD [36.1K]

Answer:

For me the answer was D

Explanation:

3 0
3 years ago
_____ is triggered by degeneration of dopamine-producing neurons in the brain.
Xelga [282]
Parkinson’s disease is triggered by degeneration of dopamine-producing neurons in the brain. <span> <span><span> <span> Parkinson's disease is a neurodegenerative disease of the CNS resulting from degeneration of dopamine-producing neurons in a region of the midbrain called the substantia nigra. Some of the factors that induce this disease are oxidative stress<span>, inflammation, and dysfunctional mitochondria. The disease is progressive including characteristic symptoms such as tremors, muscle rigidity, loss of coordination bradykinesia (slowness and difficulty with movements), sleep disturbances...</span> </span> </span> </span></span>
5 0
3 years ago
Other questions:
  • A. Que interpretación o explicación le puedes dar a la cita "… las formas interminables más bellas y más maravillosas han evoluc
    15·1 answer
  • Corals are polyps of coelenterates (cnidarians) that contain numerous algae in their tissues. the algae contain photopigments th
    14·1 answer
  • A colorimeter is an instrument used for chemical analysis by comparing a liquid’s color with standard colors. In an experiment,
    15·2 answers
  • The electron arrangement for argon, which has 18 electrons, is
    11·1 answer
  • Which of these is correct? A) Oxygen + Sugar → Energy + Carbon dioxide + Water B) Carbon + Sugar → Energy + Carbon dioxide + Wat
    6·1 answer
  • the saclike shape of lipocytes allowing them to store more fat is an example of The following them in biology structure to the f
    7·2 answers
  • Why does a cell swell in a hypotonic solution?
    7·1 answer
  • How is E. coli like a paramecium
    7·2 answers
  • Why are some diseases more common in certain groups of people, such as caucasians or African Americans
    13·1 answer
  • WILL MARK BRAINLIEST
    13·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!