Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Chemical elements are important to living organisms because they make up the organic molecules that are found in all living things
Answer:
Bog
Explanation:
A type of standing-water habitat in which the soil is acidic and decay is slow is called a <u>bog</u>.
Parkinson’s disease is triggered by degeneration of dopamine-producing neurons in the brain. <span> <span><span> <span> Parkinson's disease is a neurodegenerative disease of the CNS resulting from degeneration of dopamine-producing neurons in a region of the midbrain called the substantia nigra. Some of the factors that induce this disease are oxidative stress<span>, inflammation, and dysfunctional mitochondria. The disease is progressive including characteristic symptoms such as tremors, muscle rigidity, loss of coordination bradykinesia (slowness and difficulty with movements), sleep disturbances...</span> </span> </span> </span></span>