1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
densk [106]
4 years ago
5

Which does not occur during translation?

Biology
2 answers:
vazorg [7]4 years ago
6 0

Answer:

The transcription of DNA into a complementary strand of mRNA does not take place in translation.  

Explanation:

erma4kov [3.2K]4 years ago
5 0

Answer:

It is not rotated, flipped, or changed in size

Explanation:

Translation means that it is only moved on the coordinate plane without affecting it in any other way.

You might be interested in
A man with hemophilia and a normal woman who is a carrier for hemophilia plan to have children. The Punnett square represents th
aleksley [76]
The chance that any children would be 50%
3 0
4 years ago
C6H12O6 + O2 --> CO2 + H2O + ATP
stiks02 [169]

There are, 7 Carbon atoms, 10 Oxygen atoms, 12 Hydrogen atoms in the reactants and 1 Carbon atom, 3 Oxygen atoms, 2 Hydrogen atoms in the products.

<h3>How to count the number of atoms in reactants and products?</h3>

  • Write down the chemical formula that is:
  • C_{6} H_{12} O_{6} + O_{2} → CO_{2} + H_{2} O + ATP

  • List all the atoms present in the equation:

C

H

O

  • Count the number of atoms of the element of each molecule in the reactant.

C=6

O=8

H=12

  • Count the number of atoms of the element of each molecule in the Product.

C=1

O=8

H=2

Hence there are,  6 Carbon atoms, 8 Oxygen atoms, 12 Hydrogen atoms in the reactants and 1 Carbon atom, 3 Oxygen atoms, 2 Hydrogen atoms in the products.

Refer the following link to know more about Atoms in equations:

brainly.com/question/7181548

#SPJ1

5 0
2 years ago
A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi
Digiron [165]

Answer:

Explanation:

  1. ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
  2. ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
  3. Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.
4 0
3 years ago
Do u know who drew this and what they used (pastel or chalk)
aivan3 [116]

Answer:

art marker

Explanation:

5 0
4 years ago
Read 2 more answers
What is topography and how does it affect the desert climate
Masja [62]

Answer:

Explanation:

topography is the science that transfers the structure of the place to the paper

8 0
3 years ago
Other questions:
  • Chap 2.3 biology;;
    10·1 answer
  • Which organelle receives ribosomes from the nucleus?
    11·1 answer
  • Barnacles and mussels compete for space on rocks. Which of the following is another good example of an interaction that is best
    14·1 answer
  • How can you represent a function
    9·1 answer
  • Onvoluta worms hatch in early spring. They crawl about in the mud feeding on algae, which find their way into the skin of the wo
    11·1 answer
  • How do astronomers measure distances to stars?
    15·2 answers
  • Which phrase best describes a biogeochemical cycle? A.) The movement of a chemical substance through Earth's bodies of water. B.
    7·2 answers
  • Why is an egg cell bigger than a sperm cell
    15·2 answers
  • What is something that happens during translation
    7·2 answers
  • The thymus is the only lymphoid organ that does not: A) have lymphocytes B) produce hormones C) have a cortex and medulla D) dir
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!