In this question we will do a Biological Classification History Check.
<h3>1. Binomial nomenclature</h3>
Binomial nomenclature or binary nomenclature designates the set of rules that regulate the attribution of scientific names to species of living beings.
<h3>2. Domain</h3>
Is based on molecular phylogeny data. According to Woese, there are three domains: Archaea Domain, Bacteria Domain, and Eukarya Domain.
<h3>3. Both focus on illustrating taxonomic relationships between organisms.</h3>
No, binomial nomenclature is for the purpose of assigning names.
<h3>4. domain, kingdom, phylum only.</h3>
No, the classification is more extensive
<h3>5. juglans nigra</h3>
It is a tree that can reach heights between 20 to 50 m. It is still a monoecious, deciduous and aromatic tree.
Learn more about Binomial nomenclature in brainly.com/question/9837065
Antheridia- is reproductive that produces MALE gametes. AND
Archegonia- is reproductive that produces LADIES gametes
Changes to the drug may be helpful if it turns out that one is the source of the problem. Mechanical aids: Penile implants and vacuum devices may be able to assist males with erectile dysfunction (the inability to achieve or maintain an erection).
Any stage of the sexual response cycle is susceptible to sexual dysfunction. You are unable to enjoy sexual activities to your delight.
The classic stages of the sexual response cycle include anticipation, plateau, climax, and resolution. Both arousal and desire are a part of the sexual response's excitement phase. It's vital to understand that women don't always experience these phases sequentially.
The Sexuality Information and Education Council of the United States (SIECUS) states that a sexually healthy teen demonstrates or has the following characteristics in their interactions with classmates, parents and other members of their family, as well as other close friends and intimate partners.
Learn more about to sexuality visit here:
brainly.com/question/28319485
#SPJ4
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
B. xylem and phloem. they transport water and nutrients throughout the plant
