Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
OH or Hydroxide is a molcule
The basic steps of light-dependent reactions are:
• Light absorption in Photosystem II (PSII) and excitation of PSII
• ATP synthesiS-proton gradient in electron transport chain isdriving ATP production in a process of chemiosmosis
• Light absorption in Photosystem I (PSI) and excitation of PSI
• Reduction of NADP+ and the photolysis of water.
Answer:
Explanation:
why doesnt Dr. Bayul tell you the anwser hes a rock formation guy not you if you dont know the anwser
A fertile soil is best for growing plants
