The answer you are looking for is:
D.) Eukaryote
Hope that helps!!
Have a wonderful day!!
Answer:
Im pretty sure its B.
Explanation:
if you live in the inland the weather is much different then on the coast, the thing that contradicts this is mainly sea breeze which cools you but doesn't change the UV index. Im no meteorologist but thats just my personal idea of things. My answer may not be spot on with that subject so double check first.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
If limestone reacts with limestone, it can turn into a limestone. The reason behind this formation is that, both substances have the same chemical and physical properties and molecules of limestone have a strong chemical bonds between them so it is difficult to separate them from each other.
