1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
vitfil [10]
3 years ago
8

You are thinking about opening a restaurant and are searching for a good location. From research you have done, you know that th

e mean income of those living near the restaurant must be over $85,000 to support the type of upscale restaurant you wish to open. You decide to take a simple random sample of 50 people living near one potential location. Based on the mean income of this sample, you will decide whether to open a restaurant there. Describe a Type I and a Type II error, and explain the consequences of each
Mathematics
1 answer:
harina [27]3 years ago
6 0

The type I error and type II error can be described as follows:

Type I error: We can conclude that if the mean exceeds $85000, when in fact it does not. Thus, opening your restaurant in a locale that will not support it).

Type II error: We can conclude that if the mean income does not exceed $85000, when in fact it does. Thus, deciding not to open your restaurant in a locale that will support it.

<h3>What is a Type I and a Type II error?</h3>

A Type I error in statistics is described as rejecting the null hypothesis when it is actually true, and a Type II error is defined as failing to reject the null hypothesis when it is genuinely untrue.

The type I error and type II error can be described as follows:

  • Type I error: We can conclude that if the mean exceeds $85000, when in fact it does not.
  • Type II error: We can conclude that if the mean income does not exceed $85000, when in fact it does.

The consequences of each error are:

If you launched your business in an inappropriate location, you would incur a financial loss before realizing your error.

If you do not open your restaurant in an ideal location, you will miss out on the potential to make a profit, but you will not necessarily lose money.

Learn more about type I error and type II error here:

brainly.com/question/16012410

You might be interested in
What is the solution to the equation x over 3 + x over 6 = 7 over 2
Romashka [77]

Answer:

x=7

Step-by-step explanation:

The given equation is:

\frac{x}{3}+\frac{x}{6} = \frac{7}{2}

Multiplying both sides by LCM of 3 and 6

So,

\frac{x}{3}*6+\frac{x}{6}*6 = \frac{7}{2}*6\\2x+x=7*3\\3x=21\\\frac{3x}{3} =\frac{2}{3}\\ x=7

Hence, the solution of the equation is x=7 ..

7 0
4 years ago
Read 2 more answers
Given: sin (A) = 5/13, pi/2 &lt; A &lt; pi and tan (B) = - sqr root 13, pi/2 &lt; B &lt;. What is tan(A - B)? A. (5 + 12sqr root
Ilya [14]

Answer:

The answer is D

Step-by-step explanation:

Plz brainlist

4 0
3 years ago
Find the image of the given point
hichkok12 [17]

Answer:

egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw

6 0
3 years ago
. Find the missing term of the following arithmetic sequence. –2, __, 2,
Kisachek [45]

Answer:

0

Step-by-step explanation:

it looks like the term is increasing by 2 each time

7 0
3 years ago
What is the slope of the line that passes through the poitns (3, 1) and (-2, 5)
Anna007 [38]

Answer:

-4/5

Step-by-step explanation:

m=y2-y1/x2-x1

=5-1/-2-3

=-4/5





4 0
4 years ago
Read 2 more answers
Other questions:
  • if two angles are complementary the larger angle is 46 degrees which is three times larger than the smaller angle what is the sm
    10·1 answer
  • Classify each number below as a rational number or an irrational number. −17.6 , 81 , 15π , (square root −29), 13/14
    7·1 answer
  • What is the volume of the rectangular pyramid shown below?<br>9 in.<br>8 in.<br>7<br>in.​
    15·1 answer
  • PLZ HELP BRAINLIEST!!! solve for v <br><br><br>d=m/v
    15·2 answers
  • The histogram below shows the grade ranges for Mrs. Granderson's class.
    9·2 answers
  • 2(4 + 7) − 8 ÷ 2 whats the answer
    6·2 answers
  • No links please 15 Points
    15·1 answer
  • Melanie buys 6 basketballs and 2 volleyballs for 114. A volleyball cost her 3 less than a basketball. How much did each volleyba
    14·2 answers
  • Which expressionis equivalentto 83,100 in expand formusing power of 10?​
    7·1 answer
  • CAN SOMEONE HELP ME PLEASE ASAP!
    5·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!