1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Alexeev081 [22]
1 year ago
7

Describe the role of enzymes in the digestion of proteins in a mammal

Health
1 answer:
zalisa [80]1 year ago
8 0

Enzymes chemically breakdown protein molecules during digestion. Details about enzymes can be found below.

<h3>What are enzymes?</h3>

Enzymes are globular protein that catalyses a biological chemical reaction.

A specific type of enzyme is called digestive enzymes and they function to breakdown large food molecules into smaller ones.

Protein is a biological molecule that is broken down by enzymes during digestion to synthesize amino acids.

Therefore, enzymes chemically breakdown protein molecules during digestion.

Learn more about enzymes at: brainly.com/question/14953274

#SPJ12

You might be interested in
PLEASE help i dont know how to do this BTW this is science not health
Sauron [17]

Answer:

simple

Explanation:

go and ask your father and son and I am a dai ❤️ I have my own and a gate alarm a wall is 45 m long term relationship rakhera I will be in na gare du message garnu parxa ta and I am a little more than one aani sakyo aani sci USA a wall is a gate alarm device of claim a refund for the cement and concrete floor at the cement ltd is 45 I will leave the house is 45 m long term relationship between the two window or any other information that u will win y the way Uri a gate way I can do it contain information that u love to have my exxxxx I am very excited to improve the cement work with you and your family and friends ko ta malai ni aayo ️️ I am a love of God bless you and I am very interested to improve the cement work with the cement work

5 0
3 years ago
Drag the tiles to the correct boxes to complete the pairs. Match the type of pots and pans with their descriptions. sauté pan ro
mariarad [96]
They would do to the 4th quart
7 0
3 years ago
Read 2 more answers
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
2 years ago
The medical term for an elongated face is
kifflom [539]
<span>Dolichofacial is the medical term used in referring to an elongated face. This is a structure where a person has a disproportionate or elongated facial structure. This is one of the many facial types that vary in individuals. Through tests performed by experts, they found out that subjects who have an elongated face are more attractive than the other facial types. In their studies they also included that levels of attractions are prominent and determined immediately through facial structures and types. </span>
5 0
3 years ago
Why are proteins,fats,carbs,minerals and vitamins important to the diet
r-ruslan [8.4K]
<span>Proteins: help develop muscle tissue and function. Protein is necessary to make the hair, skin, nails, muscles, organs, blood cells, nerve, bone and brain tissue, enzymes, hormones and antibodies.
</span><span><span>Protein builds new cells and fixed damaged ones in all parts of your body<span>.</span></span>
 Vitamins: are important for metabolism and for our bodies working properly.

minerals:
bodily functions.

Carbohydrates for energy
</span>

4 0
3 years ago
Other questions:
  • 10 year old girl is scheduled for her yearly physical with her pediatrician. at the time of the visit, the patient complains of
    10·1 answer
  • Is weight the only indicator of how healthy a person is
    10·1 answer
  • Children's brains increase in size as a result of social interaction and learning experiences.​
    13·1 answer
  • Describe how glucose tolerance testing can be used to diagnose diabetes
    12·1 answer
  • Meaningful Use (MU) does not provide incentives to eligible professionals, hospitals, and critical access hospitals participatin
    10·1 answer
  • Attacking the obesity epidemic by first figuring out its cause
    8·1 answer
  • HELL FAST PLEASE
    15·1 answer
  • What is associated with over nutrition
    6·1 answer
  • Mei Ling wants her family to eat healthy foods. It’s just that she works full time, and by the time work is over and her kids ar
    8·1 answer
  • Which of the following is NOT an important part of exercise clothing? A. Belts B. Shoes C. Shirts D. Socks Please select the bes
    15·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!