Answer:
Ozone layer... pollution
Explanation:
The ozone layer is a layer in the atmosphere which provides a barrier between harmful UV rays and the Earth. However, pollution is quickly depleting the layer which in turn creates a higher risk of skin cancers and other conditions caused by harmful UV rays.
Answer:
39.82 %
Explanation:
Proteins and carbohydrates provide 4 calories per gram. On the other hand, fats provide 9 calories.
We can first calculate the calories of protein + carbohydrates:
(30g + 4g) x 4 = 136 calories
And we must calculate the calories provided by fat:
10g x 9 = 90 calories
Now to get the percentage we must see how many calories the dessert has in total:
136 + 90 = 226 cal
This represents 100% of calories. And now we need to find out how much 90 calories are from the total.
226 cal -----> 100%
90 cal ------> X
(90 x 100) / 226 = 39.82 %
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Lateral meristematic tissue to grow wider and phloem and xylem for producing vascular tissue
400k acres have been destroyed by logging
