Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
A,C E
Explanation:
The inner membrane of the mitochondria separate the matrix of the mitochondria from the cytosol(inner membrane space.). It is invaginated folded inwards to form the critae. This is an adaptive feature to increase the surface area for biochemical reaction in the mitochondria.
The invagination gives two compartments the inner mitochondria also creates the outer intermembrane space and the inner matrix
These are the substances that can pass freely the inner membrane of the mitochondria.Pyruvate and H+ can not pass through.Specifically,it is not preamble to H+ because, hydrogen ions are needed to generate the electrochemical gradients needed for the chemical energy for phosphorylation of ADP by P to form ATPs by the enzyme ATPase synthase.If the inner membrane is permeable to H+ the electochemical gradient will not be produced, and therefore ATPs productions stops.
O2 needs to pass through the inner membrane because it it the final electron acceptor. Therefore if not allowed to pass through oxidative phosphorylation and ETC will nor occur.
CO2 must pass through because its accumulation will increase the acidity of the inner mitochondria
so, an example of something that might not be a substrate is the animal itself.
explanation
substrate is the surface of where living animals, live.
sorry if this doesnt help.
HAPPY ALMOST HALLOWEEN
Answer:
Telephoto Lenses Are Combinations of Convex and Concave Lenses. Most optical devices make use of not just one lens, but of a combination of convex and concave lenses. For example, combining a single convex lens with a single concave lens enables distant objects to be seen in more deta
Explanation: