1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Tom [10]
3 years ago
11

Which part of a lake is most likely to be aphotic? ]

Biology
2 answers:
stealth61 [152]3 years ago
7 0
The Benthic zone would most likely be the part of a like wherein it is mostly aphotic in nature. In addition, the benthic zone is usually located at the bottommost layer of the lake wherein it is usually characterised by having sediments that support huge amounts of vegetation on the layer.
max2010maxim [7]3 years ago
5 0

Answer: C. Benthic zone

Explanation:

The aphotic zone is the part of the lake or ocean which receives very little or no sunlight. It is usually found in the regions of oceanic depths where only 1% of the sunlight penetrates. Due to lack of proper sunlight no photosynthesis occur in this region.

The benthic zone is the lowest level of the oceanic or lake water body, it receives very little or no sunlight. The zone remains dark without light. The animals exhibit special adaptation called as bio luminescence for producing their own light to search food and mates.

On the basis of the above explanation, Benthic zone is the most likely to be aphotic.

You might be interested in
What animal has 32 brains?​
hammer [34]

Answer:

Leeches have 32 brains,,,

8 0
2 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Some _____ are necessary for the survival of living organisms.​
san4es73 [151]

Answer:

Living things

Explanation:

Living Things depend on OTHER LIVING THINGS and NON-LIVING THINGS to survive.

4 0
2 years ago
Read 2 more answers
Plants that are grown from undifferentiated cells of leaves, stems, or roots are produced by
svetoff [14.1K]
I think it’s B, but i could be wrong
6 0
3 years ago
Read 2 more answers
What is absolute magnitude? <br>(In your own words) ​
Montano1993 [528]

Answer:

measure of the intrinsic luminosity of a celestial body (such as a star) expressed as the apparent magnitude the body would have if viewed from a distance of 10 parsecs.

Explanation:

4 0
3 years ago
Other questions:
  • The two inner planets that have a natural satellite (moon) are Earth or Venus and Mercury or Mars.
    14·2 answers
  • Guys can you help with two questions?
    12·1 answer
  • Why do phospholipids form a bilayer in water?
    14·1 answer
  • Predict which of the three treatments will have the most and the fewest
    5·1 answer
  • Why is the study of human geography important?
    7·1 answer
  • HURRY PLS!! The structure of DNA resembles a twisted ladder. Which structural components from the rungs of the ladder
    12·1 answer
  • Primary endocrine disorders may be due to damage to the hormone producing organ. karen’s thyroid gland suffered damage from repe
    6·1 answer
  • If photosynthesis is happening which of the following would you expect to happen? Choose all that apply.
    6·1 answer
  • Please Help! Which material undergoes radioactive decay? A) all elements that have a half-life B) all elements that contain atom
    6·1 answer
  • Please help :( this is a really complicated question
    7·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!