Social media help in addressing substance abuse through awareness and sensitization are going on to make know of the harm and danger in substance abuse.
<h3>What is social media?</h3>
Social media are online platforms that allows the user to create, write or display content and share with viewers and it also helps to access information and participate in many social networking.
Socal media campaigns have been done on television programs and other social media platforms to prevent the illicit use of drug by young and old people. This is because most young people visit the online platforms more and awareness and sensitization are going on to make know of the harm and danger in substance abuse.
Therefore, media help in addressing substance abuse through awareness and sensitization are going on to make know of the harm and danger in substance abuse.
Learn more on social media here,
brainly.com/question/3653791
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
neutral mutations
Explanation: i did this in class
Explanation:
D) 75 J
Energy is neither related nor destroyed- it's simply converted to different forms. Forces are vectors with both mass and acceleration; they are interactions that have the ability to change an object's motion. As objects move, their potential energy (apprx 100 J) is converted to kinetic energy. However, friction a resistive force, which is formed from the conversion of an object's kinetic energy into heat energy, as two surfaces move along each other.
With the reduction of friction, the energy output should increase, as less energy is lost as heat. Thus, the output should be 75 J.
Learn more about energy flow at brainly.com/question/6966886
#LearnWithBrainly
