1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Zanzabum
3 years ago
11

Larry is taking a walk in the park. The pollen in the air makes him sneeze constantly. What line of defense is his immune system

exhibiting?
A.
first line of defense
B.
second line of defense
C.
third line of defense
D.
fourth line of defense
Health
2 answers:
Daniel [21]3 years ago
4 0

Larry is taking a walk in the park. The pollen in the air makes him sneeze constantly. The line of defense that is his immune system exhibiting is that of "(A) first line of defense." There are only 3 lines of defense in the immune system. The first line of defense are a combination of physical and chemical barriers that prevent all types of foreign agents from penetrating the outer layer of the body. In this case, it is the nasal cavity.

ivanzaharov [21]3 years ago
4 0

Answer:

A. first line of defense

Explanation:

  The immune system is a set of elements existing in the human body which interact with each other and aim to defend the body against disease, viruses, bacteria, microbes and others.  The human immune system serves as a barrier that protects us from unwanted elements (like bacterias, microbes etc), antigens, that try to invade our body. So, it represents the defense of the human body.  The body's defense process through the immune system is called the immune response and there are 2 types of immune responses: innate, natural or non-specific and acquired, adaptive or specific.

   Innate or natural immunity is our first line of defense. This type of immunity is already born with the person, represented by physical, chemical and biological barriers.  This is case of Larry, which the pollen (antigen) got in contact with the barrier of Larry's body, which is the mucus: a fluid produced by the body that has the function of preventing microorganisms from entering the respiratory system.

You might be interested in
Which of the following is NOT a good tip for critical thinking? A. balance reason and emotion B. differentiate between reliable
Debora [2.8K]
Following your instincts is not what a critical think should do.
6 0
3 years ago
Which of the following statements is not true about cuban currency
FromTheMoon [43]
Please give the following statements

5 0
3 years ago
Match the following. 1. provide over twice as much energy per gram as carbohydrates and proteins water-soluble 2. sixty percent
Vaselesa [24]

<u>1. provide over twice as much energy per gram as carbohydrates and proteins---------fats</u>


Fats are the slowest source of energy however the most vitality proficient type of nourishment. Every gram of fat supplies the body with around 9 calories, more than twice that provided by proteins or starches. Since fats are such an effective type of vitality, the body stores any overabundance vitality as fat. The body stores overabundance fat in the abdomen and under the skin (subcutaneous fat) to utilize when it needs more vitality. The body may likewise store overabundance fat in veins and inside organs, where it can square blood stream and harm organs, regularly causing serious disorders.  


<u>2. sixty percent of the body-------water </u>


Body water is a critical measure with regards to a sound body. The human body needs water to work the correct way. Finding the ideal equalization in your body water is critical. Your water admission ought to repay the loss of body water. Water is of real significance to every single living thing; in a few life forms, up to 90% of their body weight originates from water. Up to 60% of the human grown-up body is water.  


<u>3. amount of water you need to drink daily-----6-8 cups</u>


Water is a basic supplement. It is important to support all types of life, and people can just carry on a couple of days without it. It is additionally a stimulating drink.  

The advice to drink eight 6 to 8 cups of water a day is essential for us but this advice is not based on any evidence.

The measure of water we require relies upon individual needs and conditions, including activity and atmosphere.


<u>4. necessary assistants to chemical processes in the body----------vitamins </u>


Vitamins assume numerous essential roles in your body, for example, keeping up sound eyes and skin, going about as cancer prevention agents to shield your cells from harm, and adding to solid proliferation and development, solid bones and ordinary blood coagulating. Diverse nutrients are found in foods from grains, vegetables, natural products, dairy items, and meats/beans. By eating an assortment of supplement thick foods from the 5 nutrition classes, you will have a nutrient rich diet.  


<u>5. provides you with the right amount of all the nutrients you need------balanced diet  </u>


A balanced diet is one that gives your body the supplements it needs to work accurately. The quantity of calories in a nourishment is an estimation of the measure of vitality put away in that sustenance. Your body utilizes calories from sustenance for strolling, considering, breathing, and other critical functions.The wellspring of your day by day calories is similarly as imperative as the quantity of calories you consume.  


<u>6. elements that are necessary to certain body processes-------minerals   </u>


Minerals are inorganic substances required by the body in little sums for an assortment of capacities. These incorporate the development of bones and teeth; as fundamental constituents of body liquids and tissues; as segments of chemical frameworks and for typical nerve work.  

Minerals are frequently consumed all the more effectively by the body whenever provided in foods as opposed to as supplements.


<u>7. Vitamin C and Vitamin B are examples of this kind of vitamin----------water-soluble </u>


Vitamins are fundamental supplements found in foods. They perform explicit and fundamental capacities in an assortment of body frameworks, and are essential for keeping up ideal health.  

B-complex vitamins and vitamin C are water-soluble vitamins that are not put away in the body and should be supplanted every day.  

These vitamins are effectively annihilated or washed out amid sustenance stockpiling and readiness.  

The B-complex group is found in an assortment of foods: oat grains, meat, poultry, eggs, angle, drain, vegetables and new vegetables.

8 0
3 years ago
What is NOT a way of getting someone out in baseball
Leno4ka [110]

Answer:

Tagging

Explanation:

5 0
3 years ago
Read 2 more answers
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
1 year ago
Other questions:
  • The hormone responsible for establishing sleep and wake patterns is called
    6·2 answers
  • If you have a muscle that atrophied muscle would be​
    7·1 answer
  • After wisdom teeth removal how long does it take to stop bleeding
    9·1 answer
  • According to the textbook, the worst parents are those who are
    15·1 answer
  • Give an example of an whole grain product
    12·1 answer
  • Apples are loaded with what?
    8·2 answers
  • A school-age child's
    6·1 answer
  • What is the difference between aerobic and anaerobic fitness?
    14·2 answers
  • Incentive theory supports the claim that people are motivated to engage in certain behaviors based on what they think the outcom
    14·2 answers
  • 50 POINTS<br> PLEASE TELL ME THE ANSWERS AND TELL ME IF I GOT ANYTHING WRONG. PHOTO ATTACHED
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!