In the military strategy of the south the army remains effective, and mobile before an enemy that is stronger to wear it off over time. The plan of the military strategy of the north has three steps: the Union called for the blockade of the south coast, the capture of Richmond, the capture of Mississippi R. With this plan they toppled the south.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The answer is rr because if it were "Rr" it would be round. Dominant always exceeds the recessive. so if both traits were recessive, it would be recessive. so "rr" is your answer
Explanation:
Phototropism- a response to <u>light stimulus</u> that directs the stem to grow toward the light and roots to grow away from it.
ii. Gravitropism- Stems and leaves grow away from the force of <u>gravity</u> while roots grow toward it.
iii.Thigmotropism - growth in response to <u>touch stimulus.</u> The side of the stem in contact with the object grows slower than the side not in contact. This causes the vine to twist around the object.
2. Increases
but you might have to double check this
