Rosalind Franklin's x-ray diffraction images of DNA gave James Watson and Francis Crick information about DNA's

1 answer:

5 0

Description:How an X-ray diffraction pattern is created and how the DNA X-ray diffraction pattern can be interpreted to give the dimensions. (DNAi location: Code > Finding the Structure > piece of the puzzle > Franklin's X-ray)Transcript:This is the X-ray crystallograph pattern of DNA obtained by Rosalind Franklin and Raymond Gosling in 1952. It is know as the B-form. It was clearer than the other X-ray patterns because water was included in the DNA sample. Both James Watson and Francis Crick were struck by the simplicity and symmetry of this pattern. The distinctive "X" in this X-ray photo is the telltale pattern of a helix. Because the X-ray pattern is so regular, the dimensions of the helix must also be consistent. For example, the diameter of the helix stays the same..........Keywords:x ray diffraction,x ray crystallography,rosalind franklin dna,diffraction pattern,ray pattern,s college

You might be interested in

Organic compounds ____________ (are/are not) only generated by living things.

goblinko [34]

ANSWER: Are.

Organic compounds are only generated by living things.

Hope this helps! :)
Have a lovely day! <3

4 0

3 years ago

A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi

Digiron [165]

Answer:

Explanation:

ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.

4 0

3 years ago

A trait has two alleles, represented by p and q. If p = 0.89, what is q?

Sholpan [36]

0.11

Hope this helped

Brainliest?

8 0

3 years ago

In which domain would you place the kingdom archaebacteria?

kobusy [5.1K]

Answer:

Explanation:

The kingdom you would put archaebacteria is the kingdom called archaebacteria

7 0

3 years ago

A source of emf is connected by wires to a resistor, and electrons flow in the circuit. The wire diameter is the same throughout

Ivenika [448]

After leaving the source of emf, an electron's potential energy is lower.

<h3>Describe electromotive force.</h3>

The voltage or potential difference of a battery or other electrical energy source is known as the electromotive force. A resistor is where the emf is coming from. The potential energy of an electron will now be higher than the potential energy of an electron before it leaves the source emf.

Now, the potential energy of an electron before leaving the source of electric current will be greater than the potential energy of an electron after leaving the source of electric current because the resistor connected to the source of electric current will reduce the potential energy by converting some of the energy to heat.

To know more about electromotive force visit:-

brainly.com/question/13753346

#SPJ4

6 0

1 year ago