Pretty sure its Ph scale i did a question like this once but i cant remember....its either Ph or richer
Answer:
The subphylum Chelicerata (New Latin, from French chélicère, from Greek χηλή, khēlē "claw, chela" and κέρας, kéras "horn")[1] constitutes one of the major subdivisions of the phylum Arthropoda. It contains the sea spiders, arachnids (including scorpions, spiders, and potentially horseshoe crabs[2]), and several extinct lineages, such as the eurypterids.
I'm not sure how exactly you wanted this question to be answered. You're either talking about the symmetry where animals would have two legs or two arms for example and thus producing a pair of each muscle on both sides of the body, or you're refering to the development of agonistic and antaonistic muscles where each of them served a different purpose; either extending or contracting.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
In the F<span>1 </span>generation of a Mendelian cross,
only the dominant trait is visible.only the recessive trait is visible.neither the dominant nor recessive trait is visible.<span>both the dominant and recessive traits are visible.
-I believe the correct answer is "ONLY THE DOMINANT TRAIT IS VISIBLE" in F1 generation, it is when the two true breeds, both homo (same genes) cross for example, HH and hh, since H will always be present in a punnet square, the answer is ONLY THE DOMINANT TRAIT IS VISIBLE. key word VISIBLE, the dominant trait is H</span>
