Answer:
The answer is facilitated diffusion. It requires no energy because the ions are traveling down the concentration gradient. Facilitated diffusion is important for the regulation of ions in a cell. It also enables ions to pass across the hydrophobic layer of the cell membrane composed of phospholipids.
Answer:
Underground mishaps
Explanation:
Maybe hitting fault lines, pipelines, electrical type stuff, hope this helped
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Giraffe, horses, and zebras
Answer:
C) Eikaryotic cells can be unicellular and multicellular