The skin is made up of three layers, each with its own important parts. The layer on the outside is called the epidermis
B is correct
Acids are molecular compounds that release hydrogen ions. A binary acid consists of hydrogen and one other element.
It should be 322.15. Hope it helps :)
Answer:
Isotopes are atoms of the same element that have different numbers of neutrons but the same number of protons and electrons. The difference in the number of neutrons between the various isotopes of an element means that the various isotopes have different masses.
Explanation:
<h2>Follow instagrm at ➜ mvnnyvibes</h2><h2>Follow instagrm at ➜ mvnnyvibes</h2>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
