Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Option B, a generation
Explanation:
A pedigree is a tree diagram that represents the relationships between different individuals based on certain facts and medical(genetic evolutionary) histories. Basically , the branches of the tree represents the generations which allows the researcher understand how certain genetic characteristics or traits are transmitted with in a family
Such as transmission of any genetic diseases from one generation to the other.
Hence, option B is correct
This is false-- Primary producers are near the base of the pyramid because they get their energy right from the sun.
I hope this helps :)
Answer:
1. False
2. False
3. True
Explanation:
1. Compliance is the capacity of a container to increase in size to allow it hold more content. Blood vessel, arteries and veins expand (increase in volume) to be able to accommodate a surge in blood flow, which is as a result of an increase in pressure of the blood from the heart pumping of the blood
Therefore, compliance in the tendency for blood vessel volume to increase as the blood pressure <em>increases</em> not decrease
The statement is false
2. A large compliance is indicative of being highly sensitive to changes in pressure
Compliance, C = ΔV/ΔP
From the above equation, a blood vessel with a large compliance, exhibit a large increase in volume when the increase in pressure is small
Therefore, the statement 'Blood vessels with a large compliance exhibit a small increase in volume when pressure increases a small amount; is false
3. The compliance of the vein ranges from 10 to 20 times (30 times in some literature) greater than arteries. A factor which can be affected by the vascular smooth muscle contraction or relaxation
Therefore, the statement, 'venous compliance is approximately 24 times larger than arterial compliance, so as venous pressure increases the volume of veins greatly increases' is true
The correct answer is B, I know this because none of the other answers are even reasonable. For example-
A is wrong because the size of elephant tusk has not changed over time, elephant tusk just grow...
C is wrong because it makes no sense to hunt elephants with no tusk :/
D is completely wrong because tusk have nothing to do with reproduction, those are two completely separate bodily functions.........