1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
AfilCa [17]
3 years ago
5

Use the correct terms to complete the sentences that explain how the fluid mosaic model of a membrane works.

Biology
2 answers:
Studentka2010 [4]3 years ago
8 0

Answer:

The answer is:

In membranes phospholipids associate to form two layers.

Larger proteins float within the bilayer.

Integral membrane proteins can move laterally in a membrane.

Explanation:

The fluid mosaic model is a model in which the structures of cell membranes are established. The flexible layer is made up of lipids, which are interspersed with a large protein. Other molecules can enter or leave through these channels.

Ierofanga [76]3 years ago
4 0
<h3>Answer:</h3>

The Fluid Mosaic Model declares that membranes are formed of a Phospholipid Bilayer with several protein molecules drifting about inside it. The ‘Fluid’ section describes how any components of the membrane can run nearby loosely if they are not connected to different components of the cell. The ‘mosaic’ section explains the ‘patchwork’ of proteins that are detected in the Phospholipid Bilayer.

<h3>Explanation:</h3>

There is a lipid bilayer in which the protein molecules are embedded. The lipid bilayer gives fluidity and elasticity to the membrane. Carbohydrates are also found in a cell membrane. The plasma membrane is said to be two-dimensional structure or liquid we can say which does not allow the lateral diffusion of membrane components. The plasma membrane has the texture of vegetable oil at body temperature, because of which the proteins and other substances move across it. That's why the plasma membrane is described as using the fluid-mosaic model.

You might be interested in
What is shown in the imagine <br> prokaryote<br> eukaryote<br> chloroplast<br> mitochondrion
m_a_m_a [10]

"Prokaryote" is shown in the given image.

Answer: Option A

<u>Explanation:</u>

A prokaryote is a single-cell organism which is deficient in a membranous nucleus, mitochondria, or any other membranous organs. Prokaryotes are categorized into two domains: Bacteria and Archaea. At the third domain: Eukaryota, species with nuclei and organelles are located.

The asexual prokaryotes reproduce without fusion of gametes. They are considered as first living organisms. In the prokaryotes components like proteins, DNA and metabolites, overall the intra-cellular water-soluble components are enclosed by the cell membrane as situated together in the cytoplasm, rather than in separate cellular compartments.

6 0
3 years ago
Please help... getting a headache... How does natural resources onna whole impact on the earth?​
blsea [12.9K]
In short, raw material extraction and processing always impact on the environment, resulting as they do in soil degradation, water shortages, biodiversity loss, damage to ecosystem functions and global warming exacerbation. ... Products need energy and water, as well as land for shipping, marketing and use.

Sorry if I didn’t help
Anyways have a nice day / night! :)
6 0
3 years ago
A hypothetical population of monkeys consists of two or more phenotypically different groups who extensively interbreed with one
Sedbober [7]

Answer:

The correct answer is option a, that is, sympatric speciation.

Explanation:

Speciation, which takes place when two groups of similar species live in a similar geographical location, however, they evolve distinctly unless and until they no longer interbreed and are regarded as different species is termed as sympatric speciation.  

Sympatric speciation is not similar to other kinds of speciation, in which the formation of a new species takes place when a population gets differentiated into two groups because of migration or geographic barrier. The sympatric speciation can be witnessed in various distinct kinds of species. Thus, the given case of monkeys is an illustration of sympatric speciation.  

6 0
3 years ago
Changes in the gene pool can occur due to various mechanisms. From 1892 to 1954, millions of individuals emigrated (moved out) f
kherson [118]
<span>The mechanism that affected the gene pool of the immigrants that entered the United States through Ellis Island from 1892 to 1954 is B. gene flow. Gene flow is the transfer of genes or alleles from one population to another. The migration of millions of individuals from countries across the Atlantic Ocean to the United States is responsible for the changes in the gene pool of the immigrants.</span>
6 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Other questions:
  • What role does the endomembrane play
    9·1 answer
  • Fungi are classified based upon
    12·1 answer
  • A student set up four test tubes containing starch solution in which to perform starch digestion. Supplies included amylase (enz
    15·1 answer
  • Use the completed Punnett square in Part B to answer the questions below about the F2 generation.
    9·1 answer
  • Increased secretion of aldosterone would result in a(n) ______________ of blood ____________? increase, potassium decrease, volu
    5·1 answer
  • a woman who is heterozygous for hemophilia marries a normal man. what will be the possible phenotype ratio of their children?
    10·1 answer
  • If a sperm containing 46 chromosomes fused with an egg
    7·1 answer
  • learning task 1: direction: Complete the crossword on species diversity by filling in a word that fits each clue​
    5·1 answer
  • What is a stem cell?
    12·1 answer
  • Which of the following does NOT describe the plasma membrane?
    6·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!