"Prokaryote" is shown in the given image.
Answer: Option A
<u>Explanation:</u>
A prokaryote is a single-cell organism which is deficient in a membranous nucleus, mitochondria, or any other membranous organs. Prokaryotes are categorized into two domains: Bacteria and Archaea. At the third domain: Eukaryota, species with nuclei and organelles are located.
The asexual prokaryotes reproduce without fusion of gametes. They are considered as first living organisms. In the prokaryotes components like proteins, DNA and metabolites, overall the intra-cellular water-soluble components are enclosed by the cell membrane as situated together in the cytoplasm, rather than in separate cellular compartments.
 
        
             
        
        
        
In short, raw material extraction and processing always impact on the environment, resulting as they do in soil degradation, water shortages, biodiversity loss, damage to ecosystem functions and global warming exacerbation. ... Products need energy and water, as well as land for shipping, marketing and use.
Sorry if I didn’t help
Anyways have a nice day / night! :)
        
             
        
        
        
Answer:
The correct answer is option a, that is, sympatric speciation. 
Explanation:
Speciation, which takes place when two groups of similar species live in a similar geographical location, however, they evolve distinctly unless and until they no longer interbreed and are regarded as different species is termed as sympatric speciation.  
Sympatric speciation is not similar to other kinds of speciation, in which the formation of a new species takes place when a population gets differentiated into two groups because of migration or geographic barrier. The sympatric speciation can be witnessed in various distinct kinds of species. Thus, the given case of monkeys is an illustration of sympatric speciation.  
 
        
             
        
        
        
<span>The mechanism that affected the gene pool of the immigrants that entered the United States through Ellis Island from 1892 to 1954 is B. gene flow. Gene flow is the transfer of genes or alleles from one population to another. The migration of millions of individuals from countries across the Atlantic Ocean to the United States is responsible for the changes in the gene pool of the immigrants.</span>
        
                    
             
        
        
        
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.