1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
maksim [4K]
3 years ago
10

Round 907.457 to the nearest tents place

Mathematics
2 answers:
eduard3 years ago
8 0

the awnseer is 910 jfakfneanfeg

Wewaii [24]3 years ago
7 0

Answer:

The answer is 907.5.

Step-by-step explanation:

The tenths place is the number just after the decimal. To round, we need to look at the number just to the right of the digit we need to round to. In this case, that number is 5. Now, if the digit to the right is anywhere from 1-4, we round down, by which I mean we keep the number the same. But if it is from 5-9, we round up. Therefore, we round up in this case, getting 907.5.

You might be interested in
Problem example: For the given sequence: -2,2,6,10,14,18
Kobotan [32]

Answer:

<u>250</u>

Step-by-step explanation:

You can take the explicit formula and simply substitute the n value with 64:

-2 + 4 * (64 - 1)

-2 + 4 * (63)

-2 + 252

<u>250</u>

7 0
2 years ago
Please help!! I’m failing math and I have no idea what the answer is and if I don’t do my hw and keep failing I might have to re
kirill [66]

Answer:

A: 18x+15

Step-by-step explanation:

5(4x+3)-2x

Distribute the 5

20x +15 - 2x

Combine like terms

20x-2x +15

18x +15

4 0
2 years ago
Donald's car gets about 30 miles per gallon. About how many miles can Donald drive on 9.2 gallons of gas? At $3.15 a gallon, abo
denis-greek [22]
<span>30x9.2= 276 miles 9.2x3.15=$28.98 So the car can drive 276 miles if you put $28.98 of gas in it.</span>
8 0
2 years ago
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
2 years ago
Solve this system of equations by using the elimination method -2x-2y=-6, 3x+4y=8
adoni [48]

Step-by-step explanation:

- 2x-2y=-6

3x+4y=8

multiply equation (1) by 3 and equation (2) by 2

- 6x-6y=18

6x+8y=16

Add

2y=34

y= 34÷2

y=17

substitute 17 for y in equation (2)

3x+4y=8

3x+4(17)=8

3x+68=8

3x=8-68

3x=-60

x=-60÷3

x=-20

x=-20,y=17

8 0
3 years ago
Other questions:
  • George is at a water park with his family. He needs to get a tube to use for one of the rides, and he chose his color first. The
    12·1 answer
  • X=y/20-1/4 solve for y and show properties
    13·1 answer
  • .6988271188 as fraction
    6·1 answer
  • Which fraction below represents 30% in simplest form.?
    11·1 answer
  • What is the measure of AngleEDH? 10° 40° 50° 90°
    6·2 answers
  • I had to hire a plumber to come fix a leaky pipe. The first day he worked 3 hours and charged me $450. The next day he came back
    13·1 answer
  • (8*10^(3))(4*10^(8))
    6·2 answers
  • What is the slop formula?<br> A. Y2+Y1 / 2<br> B. a2 +b2 = c2<br> C. rise / run
    5·1 answer
  • Is this relation a function?
    14·2 answers
  • These marbles are placed in a bag and two of them are randomly drawn what is the probability of drawing two blue marbles if the
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!