1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
USPshnik [31]
3 years ago
8

Which of the following statements describes the value of Monasticism following the fall of Rome?

History
2 answers:
jeka57 [31]3 years ago
5 0
<span>Monasticism provided a broken Europe with a form of organization, pacifism and religious study that would help to rebuild the war-torn region.</span>
Oksana_A [137]3 years ago
5 0

Answer:

The answer is option C.

Explanation:

Asceticism (from Greek μοναχός, monachos, got from μόνος, monos, "alone") or monkhood is a religious lifestyle in which one denies common interests to give oneself completely to profound work. Ascetic life assumes an essential job in numerous Christian places of worship, particularly in the Catholic and Orthodox customs. The really general normal for devotion pursues from its definition: the ascetic isolates from society, either to stand alone as a religious loner (recluse or anchorite) or to join a network of the individuals who have isolated themselves from their surroundings with comparative aims.

You might be interested in
How do i make (Robots might help doctors take care of people) into a more persuasive sentence​
Inga [223]

Robots may be able to help doctors take care of people because of so many reasons.

your reasons can be,

Doctors will be less busy

They can keep people company

They can bring doctor tools

3 0
3 years ago
Who attempted the first voyage to the new world for England in 1583
Dafna11 [192]
Sir Humphrey Gilbert that I believe was the first to voyage to the new world of England in 1583.
6 0
4 years ago
Read 2 more answers
Look back at the paragraph you wrote for Activity 14. Now that you have finished reading the novel, add another paragraph that s
Vedmedyk [2.9K]
Ooiiuuytrrrwwassssssdddfffffffggggghhhhhhkkkllllmmnnbbvvcccz
5 0
3 years ago
Who was the first country to secure a trade route to Asia around the cape of Good Hope
Vaselesa [24]
The first country to do so was Portugal
5 0
3 years ago
Read 2 more answers
PLS ANSWER!
BigorU [14]
No he for it but he didn’t want to
8 0
3 years ago
Other questions:
  • Why was the attack on pearl harbor so devastating to the us?
    8·1 answer
  • What was the name of the area in green (3) in the early-1800s?
    12·2 answers
  • The publication of the __________ showed the American public that they had never been informed of the full story on the Gulf of
    9·1 answer
  • Another name for an indirect democracy is a __________ democracy.
    7·2 answers
  • which of the following actions is not an example of an action that may contribute to the destruction of a citys natural environm
    10·1 answer
  • The end of the cattle kingdoms and the open range was caused by all of these except
    13·2 answers
  • What changes were made to automobiles after World War II
    6·1 answer
  • Place the following events in sequence: A) Constantinople is founded; B) Commodus dies; C) Romulus Augustus surrenders Question
    11·1 answer
  • La tarea por seacaso es de comunicacion
    8·1 answer
  • Question 12
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!