The class of macromolecule a steroid belongs to is a lipid.
Answer:
False
Explanation:
Igneous rocks need more heat than metamorphic rocks.
Answer:
Temperate coniferous forest is a terrestrial biome defined by the World Wide Fund for Nature. Temperate coniferous forests are found predominantly in areas with warm summers and cool winters, and vary in their kinds of plant life.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The ATP enables the movement of transport proteins to move the ions across a cell membrane by its getting fueled by its hydrolysis
<u>Explanation:</u>
The plasma membrane is a semi permeable membrane that is the movement of molecules across the membrane is constricted. There are 2 types of moment across the plasma membrane one is the active transport and the other is the passive transport. The active transport involves the help of ATP whereas the passive transport does not involve ATP to transport the materials.
