Answer:
1. it's the cell membrane or just the cell itself
2. it's eukaryotic, I can tell because it's dividing
3. eukarya
Answer: A. Plant
Explanation:
Plants have some of the most of complex cells of living organisms because they have different roles and structures to enable the plant to survive.
These include cells like the Parenchyma, Collenchyma, Sclerenchyma, Xylem and Phloem cells. Xylem cells for instance are complex cells located within the vascular tissues of plants and help transport water and minerals to the rest of the plant from the roots. Xylem cells look long and tracheal which is to enable them carry out the aforementioned roles.
Answer:
The plasma membrane is responsible for maintaing B: homeostasis
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
I think it's b glycolysis
I said i think just be risky and put that