Answer;
Radial nerve
Explanation
-The nerve that is most likely to be damaged as a result of his injury is the radial nerve.
-The radial nerve is a nerve in the human body that supplies the posterior portion of the upper limb.
-It innervates the medial and lateral heads of the triceps brachii muscle of the arm, as well as all 12 muscles in the posterior osteofascial compartment of the forearm and the associated joints and overlying skin.
Answer:
Makali may produce only small amounts of a non-mutated (wild-type) GALT enzyme.
Makali may have normal amounts of GALT, but the enzyme may be mutated.
Explanation:
Makali is lactose intolerant because of his ancestry. Because of this he is not able to digest any lactose which indirectly protected him from galactosemia. Thus he must avoid consuming galactose. He has a low GALT or galactose 1‑phosphate uridylyltransferase activity. He has a normal amount of GALT and may produce only small amounts.
Answer:
(A)Yes.
Explanation:
Homologous structures provide evidence for common ancestry.
Good Luck
Answer:
<h3><em>Hlo </em><em>how </em><em>r </em>
<em><u>u </u></em><em><u>I </u></em><em><u>think </u></em><em><u>u </u></em><em><u>r </u></em><em><u>fine</u></em></h3>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
