Yes I am in the car now and I’m gonna get my back up lol I have a lot to go hang out with my
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
<span>d. Does sugar or salt have a greater effect on plant growth?
This question has measurable outcomes, that can be repeated and tested. </span>
When a ray passes<span> from air into glass the </span>direction<span> in which the </span>light<span> ray is traveling </span>changes<span>. ... This bending of a ray of </span>light<span> when </span>passes from one substance<span> to </span>another substance<span> is called refraction. Hope this helps!!!</span>