1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
loris [4]
3 years ago
7

Describe the parts the accessory organ play in the digestion of food

Biology
1 answer:
bekas [8.4K]3 years ago
4 0

Answer:

See the explanation below.

Explanation:

Chemical digestion in the small intestine relies on the activities of three accessory digestive organs: the liver, pancreas, and gallbladder.

  • The digestive role of the liver is to produce bile and export it to the duodenum.
  • The gallbladder primarily stores, concentrates, and releases bile.
  • The pancreas produces pancreatic juice, which contains digestive enzymes and bicarbonate ions, and delivers it to the duodenum.

The liver, pancreas, and gallbladder are considered accessory digestive organs, but their roles in the digestive system are vital.

You might be interested in
Which component is releases from the active site of an enzyme during a chemical reaction
uysha [10]
Yes I am in the car now and I’m gonna get my back up lol I have a lot to go hang out with my
5 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
A person jogging from the forest to the office covers the 6,800
Murljashka [212]
  • Total displacement=6800m
  • Time=2h=7200s

\\ \sf\longmapsto Avg\: Velocity=\dfrac{Total\: displacement}{Total\:time}

\\ \sf\longmapsto Avg\: Velocity=\dfrac{6800}{7200}

\\ \sf\longmapsto Avg\: Velocity=0.9420m/s

4 0
3 years ago
Read 2 more answers
Scientific experiments must be able to be repeated by multiple scientists to verify the results that are obtained. Which of the
Vera_Pavlovna [14]
<span>d. Does sugar or salt have a greater effect on plant growth?

This question has measurable outcomes, that can be repeated and tested. </span>
6 0
3 years ago
Read 2 more answers
Light changes direction slightly when passing from one substance to another?
DochEvi [55]
When a ray passes<span> from air into glass the </span>direction<span> in which the </span>light<span> ray is traveling </span>changes<span>. ... This bending of a ray of </span>light<span> when  </span>passes from one substance<span> to </span>another substance<span> is called refraction. Hope this helps!!!</span>
7 0
3 years ago
Read 2 more answers
Other questions:
  • Low frequency diseases can be exclusively covered by what kind of health insurance policies
    6·1 answer
  • What is the difference between an organ and organelle​
    10·2 answers
  • Tissues can best be described as
    13·1 answer
  • Will butterfly populations continue to rise throughout the world?
    9·1 answer
  • In traditional recombinant DNA technology, a desirable gene from one organism is inserted into the DNA of a host organism. Howev
    11·1 answer
  • Secondary growth in stems is usually seen in ________.
    8·1 answer
  • Does genetic drift happen in small or large populations?
    5·1 answer
  • Ciliates have a ______, which is a tougher membrane that allows them to change shape.
    14·1 answer
  • How does the waste of the pandemic relate to the biosphere?
    12·1 answer
  • A teacher is explaining to students that cells divide to make new cells. What theory is the teacher illustrating
    10·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!