Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The correct answer is- law of independent assortment
Explanation:
Law of independent assortment says that assortment of one gene pair is independent of assortment of other gene pair which means each contrasting gene pair bears no association with other pairs of contrasting character and behave and segregate independently.
This allows the combination of new characters in the offspring. So it helps in increasing the genetic variability in the gene pool. Therefore law of independent assortment tells that inheritance of one trait had no effect on the inheritance of another.
The Neural Stem Cells. Hope this helped!
Answer: Phagocytosis
Explanation:
Phagocytosis is the ingestion of cells or particles as a defence mechanism when white blood cells (macrophages) engulf foreign matter such as bacteria and viruses or as part of a digestion process in free-living cells such as amoeba.
Answer:
Todas estas referencias expresan hasta qué punto la enfermedad posee una dimensión psicológica, social y política.
Explanation:
