1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Delicious77 [7]
3 years ago
9

Which explains why this system has no solution?

Mathematics
2 answers:
den301095 [7]3 years ago
7 0

Answer:

 C. Each has a slope of –3, but one has a y-intercept of 3 and the other has a y-intercept of –1, which makes the lines parallel.

Step-by-step explanation:

Parallel lines will have no solution, since they share no points. To be parallel, they will have the same slope and different intercepts.

___

If the intercepts and slopes are the same, the lines are identical and there will be an infinite number of solutions.

natta225 [31]3 years ago
3 0

Answer:

Your Answer is C

Step-by-step explanation:

Parallel lines will have no solution, since they share no points. To be parallel, they will have the same slope and different intercepts.

You might be interested in
Thomas received $50 for his birthday. A week later, Thomas spent $20 of his birthday money on a game. How much birthday money re
SVEN [57.7K]

Answer:

There would be $30 left after he buys the game.

Step-by-step explanation:

To find this, subtract the amount he spent from the amount that he had.

$50 - $20 = $30.

7 0
3 years ago
Read 2 more answers
Plea solve i will give brainliest
Lana71 [14]

Answer: What is half of each top number?

Step-by-step explanation:

This is your answer. use a calculator it might help. Type 3.1 / 2. thats the answer to the first block. then look at block 5. 0.14. the block below is 0.7. 14/ 2 is 7. 7x2 is 14. Hope this helps

5 0
3 years ago
Read 2 more answers
You are about to toss
Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0
3 years ago
What must be added to x² + 6x²-x+ 5 to make it exact divisible by (x + 3)​
maxonik [38]

Let f(x) = x² + 6x²-x+ 5 then ,

number to be added be P

then,

f(x) = x² + 6x²-x+ 5 +P

According to the qn,

(x+3) is exactly divisible by zero then,

R=0

comparing .. we get a= -3

now by remainder theorm

R=f(a)

0=f(-3)

0=(-3)² + 6(-3)²-(-3)+ 5 + P

0= 9 + 54 + 3 + 5 + P

-71=P

therefore, -71 should be added.

Hope you understand

4 0
2 years ago
The force of gravity on Mars is different than on Earth. The function of the same situation on Mars would be represented by the
sweet-ann [11.9K]

Answer:

If thrown up with the same speed, the ball will go highest in Mars, and also it would take the ball longest to reach the maximum and as well to return to the ground.

Step-by-step explanation:

Keep in mind that the gravity on Mars; surface is less (about just 38%) of the acceleration of gravity on Earth's surface. Then when we use the kinematic formulas:

v=v_0+a\,*\,t\\y-y_0=v_0\,* t + \frac{1}{2} a\,\,t^2

the acceleration (which by the way is a negative number since acts opposite the initial velocity and displacement when we throw an object up on either planet.

Therefore, throwing the ball straight up makes the time for when the object stops going up and starts coming down (at the maximum height the object gets) the following:

v=v_0+a\,*\,t\\0=v_0-g\,*\,t\\t=\frac{v_0}{t}

When we use this to replace the 't" in the displacement formula, we et:

y-y_0=v_0\,* t + \frac{1}{2} a\,\,t^2\\y-y_0=v_0\,(\frac{v_0}{g} )-\frac{g}{2} \,(\frac{v_0}{g} )^2\\y-y_0=\frac{1}{2} \frac{v_0^2}{g}

This tells us that the smaller the value of "g", the highest the ball will go (g is in the denominator so a small value makes the quotient larger)

And we can also answer the question about time, since given the same initial velocity v_0 , the smaller the value of "g", the larger the value for the time to reach the maximum, and similarly to reach the ground when coming back down, since the acceleration is smaller (will take longer in Mars to cover the same distance)

3 0
2 years ago
Other questions:
  • Sandy takes a day off once every 4 days, and Morgan takes a day off once every 10 days. Today, both of them have taken the day o
    5·2 answers
  • In the year 2009, a person bought a new car for $17000. For each consecutive year after that, the value of the car depreciated b
    10·1 answer
  • What is the number to the right of the decimal point called?
    13·1 answer
  • 6. 2(x + 6) = 3(x + 1)
    12·2 answers
  • Consider the sequence of steps to solve the equation: 3(x − 4) + 5x = 9x − 36 Given ⇒ 3(x − 4) + 5x = 9x − 36
    9·1 answer
  • A stack of boards is 21 inches high. Each board is 1 3/4 inches thick. How many boards are there
    13·1 answer
  • There are 70 students attending summer camp, 21 girls and 49 boys. What is
    9·1 answer
  • Two competing gyms each offer childcare while parents work out Gym A charges $9.00 per hour of childcare. Gym B
    10·2 answers
  • PLEASE HELP IM BEGGING REWARD IS 70 POINTS!!!!!
    5·2 answers
  • Find the distance between two points (4, 5), (-4, -1)
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!