1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Lemur [1.5K]
4 years ago
6

A factory produces 1000 bottles of pasta sauce in a day. Fifty bottles are selected at random to determine if they weigh the cor

rect amount. The factory rejects bottles that are over or under the correct weight.
One bottle is under weight, 46 bottles are the correct weight, and 3 bottles are over weight.
Based on this random sample, approximately how many bottles will the factory reject from the day's production?
A.4
B.20
C.60
D.80
Mathematics
1 answer:
kakasveta [241]4 years ago
4 0
The answer would consiste of c
You might be interested in
The difference of 9 and the quotient of a number t and 6 is 5
Strike441 [17]
Assuming you are supposed to solve for the variable "t",

9 - (t ÷ 6) = 5

Subtract 9 from both sides.

9 - 9 - (t ÷ 6) = 5 - 9

Simplify.

- (t ÷ 6) = -4

Distribute -1 throughout the parenthesis.

-t ÷ -6 = -4

Multiply both sides by -6.

-t ÷ -6 × -6 = -4 × -6

Simplify.

-t = 24

Divide both sides by -1.

-t ÷ -1 = 24 ÷ -1

Simplify.

t = -24
3 0
4 years ago
What is long division?
iren [92.7K]
Is when you divide long numbers
7 0
3 years ago
Read 2 more answers
What is the value of m in the equation<br> zm = 16, when n = 8?
scoundrel [369]

Step-by-step explanation:

nm=16

m=16/n

m=16/8

m=2

7 0
3 years ago
Find the image of the given point
hichkok12 [17]

Answer:

egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw

6 0
3 years ago
The 12th term of GP whose<br> 1<br> first term is 1/8 and second<br> term is 1/2is
Inessa05 [86]

Answer:

jjanation:jdgjdjgdjgjkdkidjgjghdjjghhkd

3 0
3 years ago
Other questions:
  • Janice is roller skating at a constant speed away from her house. The first half of the street is flat, but the second half has
    9·1 answer
  • Dr. Don offers a tutoring service for college students. He charges $40 as a fixed rate for the first hour plus $20 for each addi
    10·1 answer
  • Find the sum of 6+(-6).
    9·1 answer
  • The marks of a student of a class are given below78, 11,99,63,94,78,36,22<br>Range of mark is​
    12·1 answer
  • 1 2 3 4 5 6 7 8 9 10 TIME REMAINING 01:47:21 Which best describes the relationship between the successive terms in the sequence
    12·1 answer
  • Mane and Seth are working on a lab activity where they are tracking some leaves that are
    6·2 answers
  • A restaurant bill came to $60. If 15% of this bill was left as a tip, how much was the tip
    13·2 answers
  • Plz plz plz help it is due in 3 hours ​
    13·1 answer
  • What is your favorite subject? <br>​
    6·2 answers
  • Katerina's phone number has ten digits in total. Now her friend Kylie wants to call her, but Kylie only remembers the first six
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!