1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
defon
3 years ago
8

Find the image of the given point

Mathematics
1 answer:
hichkok12 [17]3 years ago
6 0

Answer:

egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw

You might be interested in
What does the asterisk (*) here mean?<br> 2x*5x + 2x*9 + 7*5x + 7*9
nignag [31]

Answer:

I think it means to multiply.

Step-by-step explanation:

7 0
2 years ago
2sin^2 2x=2<br><br> In the domain [0, 2pi)
djverab [1.8K]
Please type this as 2(sin 2x)^2=2      <span>2sin^2 2x=2 is confusing.

Reducing this expression:  (sin 2x)^2 = 1

Taking the sqrt of both sides, sin 2x = plus or minus 1

If sin 2x = 1, then 2x must be pi/2 or 3pi/2, and so x must be pi/4 or 3pi/4.

Now you do this for sin 2x = -1.</span>
8 0
3 years ago
Only 30 minutes please help​
andrezito [222]

Answer:

B, and i don't for the second one

Step-by-step explanation:

4 0
3 years ago
Maria buys 15 apples at the store and places them into bags she puts 5 apples into each bag how many bags does Maria use for all
VMariaS [17]

it's 3 bags 5 times 3 is 15

6 0
3 years ago
Read 2 more answers
The approximation of which irrational number is shown by point R on the number line?
Alenkasestr [34]

Answer:

B it is very simple my friend

Step-by-step explanation:

3.75 × 3.75 = 14.0

6 0
2 years ago
Other questions:
  • Any help please asap!!!
    15·1 answer
  • Evaluate −6 − (−4).<br> −10<br> −2<br> 24<br> 2
    8·2 answers
  • CW
    10·1 answer
  • I need help plz help
    15·2 answers
  • Scientists are studying the frog population in a pond. The function g(x)=14(1.75)x can be used to determine the number of frogs
    6·1 answer
  • 6) You can buy 3 apples at the Quick Market for $1.26. You can buy 5 of the same apples at Stop and Save for $1.15. Which place
    14·1 answer
  • Find the value of x. The figures are not drawn to scale. Pis the center of the circle.
    6·2 answers
  • Simplify the algebraic expression 4(x + 1) + 7(x + 3)
    10·1 answer
  • Help please with these questions
    5·1 answer
  • Which of the graph below shows how Mary’s money will grow in each bank ?
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!