Answer:
C Noise pollution
Explanation:
because organisms create noise.
Acid reflux is a stomach acid that travels back up through the esophagus when the lower esophageal sphincter does not close properly following consumption of food. You get heart burns with acid reflux that’s why you should take Antacids. Antacid excess stomach acid to relieve heartburn, sour stomach, acid indigestion, and stomach upset. They can also be used to relieve the pain of stomach and duodenal ulcers. Alka-seltzer can also work because
When too much acid builds up in your stomach, it can feel upset. Alka-Seltzer is a "buffer" which keeps your stomach from being too acidic. This demonstration using bromphenol blue and vinegar, will show how Alka-Seltzer neutralizes stomach acid.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Feral cats threaten<span> the survival of over </span>100<span> native </span>species in Australia<span>. They have caused the extinction of some ground-dwelling birds and small to medium-sized mammals. </span>
6. Channel proteins span the membrane and make hydrophilic tunnels across it, allowing their target molecules to pass through by diffusion.
7. They move freely around the membrane.
8. Binary fission is the division of a single entity into two or more parts and the regeneration of those parts separate the entities resembling the original.