Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
did you already get the answer or you still need help
Answer:
Explanation:
halocline
wind
dissolved salts
ionic
Coriolis
Convection currents flow due to variations in the temperature and salinity in seawater, which both influence its density. Variations in density in different regions of the ocean will cause water to flow from less dense areas to more dense areas as water heats up and becomes less saline, producing a horizontal convection current. Vertical convection currents can arise as cooler, more saline water sinks, causing warmer, less saline water to rise.
52,700
is the answer
ωith this that is your answer
Blood pressure
This is indicated in Starling's Hypothesis in which there is fluid movement due to filtration across the wall of capillary. This is dependent between hydrostatic pressure gradient and oncotic pressure across the capillary. The balance of these forces allow the net driving pressure for filtration. The net fluid influc is proportional to this net driving pressure. The leakage of proteins across the capillary membrane has important effects and has corresponding cause in the balance of forces.