1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
uysha [10]
3 years ago
9

What is an active site?

Biology
1 answer:
Ierofanga [76]3 years ago
8 0

Answer:

B is correct.

Explanation:

You might be interested in
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Drag the tiles to the correct boxes to complete the pairs.
cupoosta [38]

Answer:

did you already get the answer or you still need help

4 0
3 years ago
HELP ASAP PLEASEEEE
Kruka [31]

Answer:

Explanation:

halocline

wind

dissolved salts

ionic

Coriolis

Convection currents flow due to variations in the temperature and salinity in seawater, which both influence its density. Variations in density in different regions of the ocean will cause water to flow from less dense areas to more dense areas as water heats up and becomes less saline, producing a horizontal convection current. Vertical convection currents can arise as cooler, more saline water sinks, causing warmer, less saline water to rise.

6 0
3 years ago
Read 2 more answers
What is 5.27 x 10^4 written in standard form ?
madreJ [45]
52,700
is the answer
ωith this that is your answer



7 0
3 years ago
In the capillaries, hydrostatic pressure (hp) is exerted by __________. view available hint(s) in the capillaries, hydrostatic p
pochemuha
Blood pressure

This is indicated in Starling's Hypothesis in which there is fluid movement due to filtration across the wall of capillary. This is dependent between hydrostatic pressure gradient and oncotic pressure across the capillary. The balance of these forces allow the net driving pressure for filtration. The net fluid influc is proportional to this net driving pressure. The leakage of proteins across the capillary membrane has important effects and has corresponding cause in the balance of forces.


4 0
3 years ago
Other questions:
  • What fatal infectious disease killed a large portion of the human population in 1918?
    5·1 answer
  • What can insects do that no other arthropod can do
    12·1 answer
  • Mutations ______.
    13·1 answer
  • Which are the only invertebrates that can fly?
    8·2 answers
  • How does an amoeba move?
    10·2 answers
  • Which statements accurately describe atoms? check all that apply
    13·1 answer
  • Explain how natural resources are identified and why natural resources are unevenly distributed.
    7·1 answer
  • What gives a sea squirt it's unique structure and shape?
    12·1 answer
  • Which of the following represents an explanation for the occurrence of certain behaviors, phenomena, or events?
    15·1 answer
  • In cellular respiration, glucose __________ electrons, whereas __________ electrons.
    7·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!