Answer:
not really a pro at health but I can try! I would say have a different diet while healing and stay home from soccer and let it heal. he should go to therapy daily for updates to see if his arm is healing or not. he should not take to much pressure onto his arm.
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
the fundamental unit of heredity
Explanation:
DNA is a double stranded helix structure. Each strand is made up of a string of nucleotides.
A gene is a region of DNA, usually tens of thousands of nucleotides long. At the simplest level, one gene encodes for one trait. Therefore, the gene can be described as the fundamental unit of heredity.
Genes work by coding for specific proteins, which carry out essentially all the functions in the cell.
