C.Halite is the correct answer these are formed by the evaporation of seawater and the salt remaining to help the rock to form.
Hope this helps!
Luster means to give shine to a surface. Luster is a general idea of a mineral but you may need to be more specific. By specific I mean what kind of luster does the mineral have? Metallic, Non-Metallic, Vitreous, Resinous, Pearly, Greasy, Silky, or Adamantine. These are more specific types of luster than just saying luster.
The nitrogenous base that pairs with Adenine is Thymine.
A. Water being pumped in and out of guard cells.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
