To determine whether an acidic or basic solution, it is first necessary to compare the concentrations of the hydronium (H3O +) and hydroxide (OH-) ions in the solution.
In acidic solution, the concentration of H3O + ions is higher than that of OH- ions.
- In acidic solution, the concentration of H3O + ions is higher than that of OH- ions. Such a solution can be achieved by adding a small part of the H3O + ions, for example. Acid solutions have a pH below 7, the further away from 7 the pH of the solution is the higher its acidity content. According to Le Chatelier's principle, when a disturbance is caused to an equilibrium system, it tends to readjust in order to diminish the effects of that force. This means that if an acid is added to water, the H3O + ions will be in excess and the equilibrium will shift in the opposite direction to the left. Then these excess ions will react with the OH- ions. Thus, the concentration of OH- ions will decrease and the solution will become acidic.
- In basic solutions, the concentration of OH- ions is higher than that of H3O + ions. If we add a base to the water, it means that we will be adding OH- ions and, as explained in the previous section, by Le Chatelier's principle, the equilibrium of the water selfionization reaction will shift in the opposite direction, and the excess ions will react. with the H3O + ions, decreasing their concentration and making the basic solution. Basic solutions have a pH greater than 7, the farther from 7 and closer to 14 the pH of the solution, the higher the basification content.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Heat waves can be dangerous, causing illnesses such as heat cramps and heat stroke, or even death. Warmer temperatures can also lead to a chain reaction of other changes around the world. That's because increasing air temperature also affects the oceans, weather patterns, snow and ice, and plants and animals.
Answer:
Explanation:
We are being provided with little information about the question in the study.
The 50 ml is required to make an unknown solution which has a mass of 5g,
SO, we are to determine the amount of grams that will be needed to make the product.
We are not given information about the product, as such this will be difficult and impossible to answer.
You can add the additional information required in the comment section below and further explanation and the detailed solution will be provided.
Thanks!!!
Answer: cell tissue organ and organ system.
Explanation:
