1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Alex777 [14]
3 years ago
10

A scientist observes that all people who contract a painful skin rash known as shingles have previously in their lifetime been i

nfected with chicken pox. He theorizes that the virus that causes chicken pox is the same virus that cause shingles. What type of reasoning is being displayed in this case?
Biology
1 answer:
stiv31 [10]3 years ago
4 0

Answer:

The virus that generates chickenpox disease is a virus of the family called "herpes" where once they infect the human organism they are not eliminated by human defense, but are reserved and coexist in the organism in the lymph nodes, and when faced with immunodeficiency situations for certain reasons, it generates their reactivation, manifesting a recurrence of the disease.

Explanation:

The chickenpox virus is called the Zoster chickenpox virus, once it infects the human in his childhood, it settles in the ganglion near where it is inactively inoculated.

This is reactivated again manifesting shingles or herpes zoster in adulthood and in situations of immunodeficiency as in those malnourished humans, or who are exposed to long hours in the sun, or who suffer stressful situations.

Shingles is a disease that manifests itself in a very painful way (more than chickenpox) in the form of scabs and vesicles in different possible areas.

You might be interested in
Reinforcement is most likely to occur when__________ (A) the environment is changing (B) hybrids have lower fitness than either
PolarNik [594]

So option B (hybrids have lower fitness than either parent population) is the correct answer.

What is Reinforcement?

Reinforcement is a consequence used in behavioral psychology to strengthen an organism's future behavior when that activity is preceded by a specific antecedent stimulus. This strengthening impact can be quantified as a higher frequency of behavior, a longer duration of behavior, a greater volume of behavior, or a shorter latency.

To learn more about Reinforcement

brainly.com/question/1483660

#SPJ4

5 0
2 years ago
What are Good Places To Look For Vape Trees Online without ID ?
Arisa [49]

Answer:

toys are us got some good cotton candy puffers that don't make you want to breath it like holy stuff

3 0
2 years ago
Which of the enzymes below can synthesize and proofread a dna sequence?.
Lostsunrise [7]

Answer:

exonuclease

Explanation:

According to Oxford Languages, exonuclease is:

an enzyme which removes successive nucleotides from the end of a polynucleotide molecule.

7 0
2 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Where should the majority of fat in the mediterreanean diet come from?
TiliK225 [7]
Mediterrana I think
8 0
3 years ago
Other questions:
  • A prescription for an isotonic enema is written for a 2-year-old child. what is the maximal amount of fluid the nurse should adm
    8·1 answer
  • Messages from the brain to the muscles and glands in the body begin their journey in the __________.
    6·1 answer
  • What are the proteins job in the human body?
    10·1 answer
  • PKU is a recessively inherited disease. Two
    7·1 answer
  • Why would one take vitamin supplements?
    11·1 answer
  • Four places a body fossil might be created.
    5·1 answer
  • What animals are most likely to survive in the wild?
    9·2 answers
  • A student was observing slides of cell division. In one of the slides, he noticed loosely coiled chromatin depicting DNA duplica
    14·1 answer
  • What are some substances produced by photosynthesis?​
    15·1 answer
  • What environmental factors will influence the growth of an <br> elephant?
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!