So option B (hybrids have lower fitness than either parent population) is the correct answer.
What is Reinforcement?
Reinforcement is a consequence used in behavioral psychology to strengthen an organism's future behavior when that activity is preceded by a specific antecedent stimulus. This strengthening impact can be quantified as a higher frequency of behavior, a longer duration of behavior, a greater volume of behavior, or a shorter latency.
To learn more about Reinforcement
brainly.com/question/1483660
#SPJ4
Answer:
toys are us got some good cotton candy puffers that don't make you want to breath it like holy stuff
Answer:
exonuclease
Explanation:
According to Oxford Languages, exonuclease is:
an enzyme which removes successive nucleotides from the end of a polynucleotide molecule.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.