1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
xenn [34]
3 years ago
9

If f(x)=x^2-5x and g(x)=8-x^3, evaluate the following:

Mathematics
1 answer:
MAXImum [283]3 years ago
4 0

Answer:

  a.  -25

  b.  -52

  c.  54

  d.  8/7 = 1 1/7

Step-by-step explanation:

Evaluate each of the functions for each of the variable values and compute the composite as defined.

a. (f+g)(3) = f(3) + g(3) = 3^2 -5·3 + 8 -3^3 = -25

___

b. (g -f)(4) = g(4) -f(4) = 8 -4^3 -(4^2 -5·4) = 8 -64 -16 +20 = -52

___

c. (f*g)(-1) = f(-1) · g(-1) = ((-1)^2 -5(-1)) · (8 -(-1)^3) = 6·9 = 54

___

d. (g/f)(-2) = (8 -(-2)^3)/((-2)^2 -5(-2)) = (8+8)/(4+10) = 16/14 = 8/7

<em>_____</em>

<em>Comment on approach to the problem</em>

When there are a number of evaluations of the same function with different values of the variable, it can be convenient to let a calculator or spreadsheet do those for you.

You might be interested in
The ground temperature at sea level is 60 degrees F. For every 100-foot increase in elevation, the temperature rises 1/10 of one
N76 [4]
<h3>Answer: B. 62 degrees fahrenheit</h3>

====================================================

Explanation:

x = elevation in feet

y = temperature in fahrenheit

The temperature goes up 1/10 = 0.1 degrees for every 100-foot increase of elevation. So the slope is 0.1/100 = 0.001, which tells us how fast the temperature is increasing. In other words, the temperature goes up 0.001 degrees each time the elevation goes up by 1 foot.

The ground temperature is 60 degrees, which is our starting temperature. It's the value of y when x = 0. Therefore, 60 is the y intercept.

We have a slope of m = 0.001 and a y intercept of b = 60. The equation y = mx+b becomes y = 0.1x+60

Now plug in x = 2000 to find the temperature at this elevation

y = 0.001x+60

y = 0.001*2000+60

y = 2+60

y = 62

7 0
3 years ago
Read 2 more answers
Select the two statements that are true about the equation y+6=−10(x−3).
qwelly [4]

I have taken that test (although I don't see you're statements)

I believe the statements to choose from are:

A.) The slope of the line is −10.

B.) The slope of the line is 3.

C.) One point on the line is (3, 6).

D.) One point on the line is (3,−6)

<u>The answers are:</u>

A.) The slope of the line is -10

D.) One point on the line is (3,-6)

<u>Explanation: </u>

The given equation of line is (1).  The point slope form of a line is  (2)  Where m is the slope of line and (x₁,y₁) are points.  On comparing (1) and (2) we get The slope of given line is -10 and the line passing through the points (3,-6).

6 0
3 years ago
Heeeeeeelp pleeeease
Umnica [9.8K]

Answer:

<em>Solve for  b.  by simplifying both sides of the inequality, then isolating the variable.</em>

Inequality Form:

b < -\frac{3}{7}

Interval Notation:

( − ∞ , -\frac{3}{7} )

Hope this helps :)

<em>-ilovejiminssi♡</em>

8 0
3 years ago
How can you find the surface area of a composite solid made up of prisms ? (Help)
sammy [17]
Oh, this is easy. For any prism, you find the surface area by finding the are of all the sides. I will post all surface area formulas here, for reference
Cube:



Surface area = 6 × a2




Right circular cylinder:



Surface area = 2 × pi × r2   +  2 × pi × r × h

pi = 3.14
h is the height
r is the radius


Rectangular prism:



Surface area = 2 × l × w  +  2 × l × h  +  2 × w × h 




l is the length
w is the width
h is the height


Sphere:



Surface area = 4 × pi × r2 

pi = 3.14
r is the radius


Right circular cone:



Surface area = pi × r2  +  pi × r ×( √(h2 + r2)) 

pi = 3.14
r is the radius
h is the height
l is the slant height 


Right square pyramid:



Surface area = s2 + 2 × s × l

s is the length of the base
h is the height
l is the slant height 
8 0
3 years ago
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
3 years ago
Read 2 more answers
Other questions:
  • en un salón de clases se repartió 95 bolsas de dulces cada niño recibe 3 bolsas cuántos niños había en el salón​
    7·1 answer
  • Julie and Eric row their boat (at a constant speed) 18 miles downstream for 3 hours helped by the current. Rowing at the same ra
    7·1 answer
  • It is greater than 40 it is less than 46 it has a 5 in the ones place what is the secret number
    14·1 answer
  • im sorry but im so confused T^T im so bad at these things- directions in picture NO LINKS OR YOUR GETTING REPORTED!
    8·2 answers
  • The amount of snowfall in December was 2 1/3 feet. The amount of snowfall in January was 1/14 feet. How much more snowfall was t
    14·1 answer
  • EASY POINTS !!!!!!!!!!!!!!!!!!!!
    11·2 answers
  • There are 4 quarters in 1 dollar. The total number of dollars is a function of the number of quarters. Does this situation repre
    15·1 answer
  • Pleaseee help!!!!!!!!!
    7·1 answer
  • Find the domain and range of the function without graphing. Explain how you found your answers.
    5·1 answer
  • The world record for the fastest 100-meter sack race is 39. 91 seconds. What is the athlete's average speed to the nearest hundr
    12·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!