Answer:
green light is not real light plants need the sun which produces real energy
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Https://study.com/articles/How_to_Become_a_Medical_Instrument_Technician.html Try this website! :)
Forest fires actually help the environment, they remove plants and trees that are useless and leave space for new plants and trees to grow. After 26 years after the fire, the forest will start to grow again and will be green once again.
Have a nice day! :)
