The process called menstruation.
The gastrocnemius muscle
<em>Have a luvely day!</em>
Answer:
a Anaphase I
b Metaphase I
c Telophase I
d Anaphase II
e Prophase I
f Telophase II
Explanation:
Prophase I begins after the DNA has been duplicated, as shown in picture e. The chromosomes are condensed, and also visible, which is apparent in picture e.
The next stage is called Metaphase I, in which the pairs of homologous chromosomes align at The the centre of the cell and the spindle fibres attach, as shown in picture b.
The pairs of chromosomes are pulled apart to opposite poles of the cell by the spindle fibres., as shown in picture a. This stage is called Anaphase I.
Then, a process called Telophase I occurs, when the cell divides into two daughter cells. One of these cells is shown in picture c.
Picture d shows the stage Anaphase II, where the spindle has attached and the chromatids are pulled to the opposite poles of the cell.
The final picture left is picture f, which shows the daughter cell at the end of meiosis II, where the nuclear envelope is reforming, as in telophase II.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
A photosynthetic cell within a plant leaf produces chemical energy, stored within glucose molecules.
Explanation:
The energy captured from sunlight by Photosystems in chlorophyll is used to split a water molecule and reduce carbon dioxide to carbohydrates. This energy from sunlight is therefore stored in the chemical bonds of the glucose molecules. It is thereafter harnessed during cellular respiration when the chemical bonds of glucose are broken and the energy transferred to make ATP molecules.
