Answer: Ligand gated channel
Explanation:
Ligand gated channel is an essential membrane protein that has pores and allows the passage of specific ions across the plasma membrane when it is activated by a specific chemical . Examples of such ions that pass through Ligand gated channels are Sodium ions, Potassium ions, Calcium ions. Ligand gated channels are found in extensions of the nerve cells.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: How scientists define and measure population size, density, and distribution in ... In ecology, a population consists of all the organisms of a particular species ... some methods ecologists use to determine these values for populations in ... In the end, the data can be used to estimate the population size and population density
Answer:
The concept predates the term; Plato suggested applying the principles of selective breeding to humans around 400 BC. Early advocates of eugenics in the 19th century regarded it as a way of improving groups of people. In modern usage, the term eugenics has close ties to scientific racism and white supremacism.
Explanation:
